1 / 10

Metabolism Boosting Foods: Rakhiye Apane aapko Ko Swasth

Metabolism ka hamare sharir me bahut hi mahatwapurna bhumika hoti hai. To aaiye jante hai Metabolism Boosting Foods aur rehte hai hamesha ke liye swasth. Adhik jankari ke liye: http://hrelate.com/metabolism-boosting-foods-in-hindi/

cshradhha20
Télécharger la présentation

Metabolism Boosting Foods: Rakhiye Apane aapko Ko Swasth

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. Metabolism Boosting Foods, Jo RakheAapkoSwasth HRELATE.COM

  2. Metabolism Boosting Foods Aapkesharirkoswasthrahe ne keliyeaapke metabolism ka swasthrahnabahutjarurihotahai. Jiskeliyeaiyeaajiss article mai hum aapkobatatehai, Metabolism Boosting Foods. Jisseaapswasthjivanaaram se jeesaktehai. hrelate.com

  3. Oats Foods That Increase Metabolismkibaatekare to oats ka naamsabsepahleaatahai. Oats hamare metabolism kobadhanekeliyekamal ka hotahai. Kyoki oats maimojudvasamaighulnshil fiber kotodnemailambasamaylagathai. hrelate.com

  4. Palak Palakek antioxidant yukthotahai, jo damaged maspeshiyokimarmatkartahai. Saath hi palakmai iron, vitamin C, potassium aur magnesium bhiucchmatarmaihotahai. Red meat kitulnamaipalakmaijyada iron payajatahai. hrelate.com

  5. Badam Badammaiswasthvasa, fiber aur incomplete protein kiacchikhasimatarhotihai. Jab incomplete protein ko Complete protein jesedahikesaathletehai, To aapkesharirkosabhi 9 avshayak amino acid mil jatehai. Kyokibadammaiavshayk fatty acid hotehai, Yeh metabolism kobadhathai. hrelate.com

  6. Seb Seb ka glycemic index kamhotahai, joekaaharkopundaurposhtikbanayerakhnekeliyerozkhayajasaktahai. Sebmai fiber kiucchmatrahotihai, joaapke pet kobhibhararakhtahai. Vese “apple a day keeps the doctor away” yehkahavatsahihai. hrelate.com

  7. Turkey Turkeyka protein yukt mans dublimaspeshiyoke tissue ka nirmandkarnemaimadadkartahai, jisseaapkesharirkiatirik calorie burn ho jatihaiauraapka metabolism badtahai. Turkey mai chicken kitulanmaikam saturated fat auradhik protein hotahai. hrelate.com

  8. Dahi Dahimaibahutsareprobiotichotahai, jokiswasthpachantantrakeliyeavshayakhotehai. Isliyeaapkoniyamitroop se dahikhanachahiye. hrelate.com

  9. Beans Beans fiber maiucch hone kealawakaianyegunokekaranbhikamal ka bhojanhotahai. Yeh low glycemickhadyapadarthhotehai. Iskamatlkabhaikiinkesevan se raktmai sugar kivradhinahihotihai. hrelate.com

  10. Grapefruit Grapefruit vastavmaikamalkehotehai. Yehkattephalaapkesharirmaivasakobadhane vale insulin keistarkokamkartehai. Inme fiber bhiprachurmatramaihotehai. Grapefruit kogulabiaurlaal rang lycopenekivajah se hotahai. Lycopene tumor cell ka nashkardetahaiaurkoshikaonuksaanpahuchate vale oxygen muktkando se ladnekeliyekshamtapradaankartahai. hrelate.com

More Related