1 / 21

Cool BaRC Web Tools

Cool BaRC Web Tools. Prat Thiru. BaRC Web Tools http://iona.wi.mit.edu/bio/tools/bioc_tools.html. We have tools for: General Analysis and File Utilities Genomics EntrezGene/RefSeq/UniGene/SGD/GenBank annotation Homology (Orthology) Converting IDs between databases Functional Analysis

garzae
Télécharger la présentation

Cool BaRC Web Tools

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. Cool BaRC Web Tools Prat Thiru

  2. BaRC Web Toolshttp://iona.wi.mit.edu/bio/tools/bioc_tools.html We have tools for: General Analysis and File Utilities Genomics EntrezGene/RefSeq/UniGene/SGD/GenBank annotation Homology (Orthology) Converting IDs between databases Functional Analysis Visualization

  3. General Analysis and File Utilities • Show the number of items shared and unique between two sets Venn Diagram Generator http://jura.wi.mit.edu/bioc/tools/venn.html

  4. General Analysis and File Utilities • Find what is common and unique between two listsNM_126167 NM_126167 • NM_126168 NM_322122 • XM_322082 NR_210999 • XM_322084 • NR_001321 • NM_126168 Compare Two Lists http://iona.wi.mit.edu/bell/compare.html

  5. General Analysis and File Utilities • Count the number of occurrences in a list • NM_126167 • NM_126168 • XM_322082 • XM_322084 • NR_001321 • NM_126168 Redundant List Analysis http://iona/cedrone/redundant/

  6. General Analysis and File Utilities • Select specific rows and columns in a file Submatrix Selector http://iona.wi.mit.edu/bell/submatrix_selector/

  7. Genomics • Retrieve sequence up/down stream for a list of genomic location(s) Genomic Sequence Extractor http://iona.wi.mit.edu/bell/extract_custom.html

  8. Genomics • Retrieve regions around transcription start or end site RefSeq Regulatory Extractor http://iona.wi.mit.edu/bell/refseq_extractor.html

  9. Genomics • Collapse overlapping regions into a single region Merge Overlapping Genome Regions http://iona.wi.mit.edu/bell/merge_regions/merge_regions.html

  10. EntrezGene/RefSeq/UniGene/SGD/GenBank annotation • Get information for a list of Entrez Gene IDs Entrez Gene IDs  info http://iona.wi.mit.edu/walker/webtools/locuslink-db-0.html

  11. EntrezGene/RefSeq/UniGene/SGD/GenBank annotation • Retrieve UTRs/CDS from GenBank flat file Extract UTRs and/or CDS regions from GenBank sequences http://iona.wi.mit.edu/bell/utrs/

  12. Homology (Orthology) • Find orthologous Ensembl IDs http://iona.wi.mit.edu/bell/homology/ensembl.html http://iona.wi.mit.edu/bell/comparative/

  13. Converting IDs between Databases • Convert gene ids from Entrez to Ensembl Entrez Gene IDs  Ensembl IDs  http://iona.wi.mit.edu/bell/locuslink-db-7.html

  14. Functional Analysis • Determine which pathway genes might be involved from different databases. Map Genes to Pathways http://iona.wi.mit.edu/yuan/gene2pathway/

  15. Functional Analysis • Find out which GO categories are over-represented in the GO terms Identify over-represented GO terms in a gene set http://iona.wi.mit.edu/yuan/go_anno/

  16. Functional Analysis • Find more general GO terms Walk up GO ontologies to get more general "induced" terms http://iona.wi.mit.edu/bell/go/

  17. Functional Analysis • Determine codon usage in a sequence Tabulate the number of codons in sequence data http://iona.wi.mit.edu/gurdziel/CodonCounter/CodonCounter.html

  18. Visualization • Color codes amino acids Protein Sequence Visualization Tool http://iona.wi.mit.edu/cgi-bin/walker/draw_enrichment.pl

  19. Visualization • Display occurrences of a motif Sequence Word Viewer Seq 55MTKVYANSIQQHLCLDSLTGPVRSVLTQGTTAEKERVVDRIALLERCLDPSNSLPPVRSVLTQGTTAEKVQLVVSCLGVVCSIICLALGIAAAAVTAKRLVAVAVATILAVALLVVAGLLFSGVLCSPVSVLAASLFFGVGAFLLGGALVGGVLTTEAVTRERLHRSQTLMWNNLCCKTAEVEQKISTASANAKSNDKTRKLGESeq 200MECVKQLCRNHLCLDSLTGPVRSVLTQGTTAEKVQLVVSCLGVVCSIICLALGIAAAAVGVSCSGFAIGLGVIAILLGIVLFAISALDVLEDHGLVGAASLFFGVGAFLLGGALVGGCPFKLPCKSSPANEPTVQFFKGKNGSADKVILVTQ http://iona.wi.mit.edu/rodriguez/wordview/

  20. TargetScan • Find predicted targets of miRNA http://www.targetscan.org/

  21. Need a tool? Let us know! wibr-bioinformatics@wi.mit.edu

More Related