1 / 41

Structural Characterization of Glycoproteins using Agilent 6210 ESI-TOF: Analysis of Post-Translational Modifications

Structural Characterization of Glycoproteins using Agilent 6210 ESI-TOF: Analysis of Post-Translational Modifications. Overview. Profile of Blue Stream Laboratories Case studies of protein characterization using the Agilent 6210

les
Télécharger la présentation

Structural Characterization of Glycoproteins using Agilent 6210 ESI-TOF: Analysis of Post-Translational Modifications

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript

  1. Structural Characterization of Glycoproteins using Agilent 6210 ESI-TOF:Analysis of Post-Translational Modifications

  2. Overview • Profile of Blue Stream Laboratories • Case studies of protein characterization using the Agilent 6210 • Molecular weight determination of intact small/medium/large peptides and proteins • Sequence confirmation and disulfide linkage mapping of protein • Relative quantitation of methionine oxidation

  3. Blue Stream Laboratories • Established Q1 2006 • Located in Woburn, MA • Well equipped • Glycoprotein / Peptide / Small Molecule Advanced Analytical lab • Mass Spectrometry lab • Service contracts include • Glycoprotein Structural Characterization Programs • CMC Analytical (Structure / Function) Support • Process / Comparability Programs • Large and Small Molecule Technology Transfer • Method Development / Optimization • Method Validation (ICH) • GMP Stability and Release Testing • Consulting

  4. Agilent 6210 ToF • ESI-ToF coupled to Agilent 1200 binary LC • AP-MALDI (MassTech) source available • <3 ppm mass accuracy • >17000 resolution

  5. Case Studies (1) Intact Molecular Weight Determination

  6. Experimental conditions • Injection of 0.3 ug protein in 50% ACN/0.1%TFA • 200 uL/minute flow rate • 100-3200 m/z acquisition range • Extraction of survey spectrum from TIC • Deconvolution via BioConfirm/Protein Apps

  7. TIC, sample 1: Small Protein

  8. Survey spectrum of protein peak

  9. Charge state envelope of protein

  10. Deconvolution results

  11. Deconvolution results (zoom)

  12. Deconvolution evidence

  13. MALDI-ToF of Intact Protein

  14. ESI-ToF: TIC of Intact Protein

  15. ESI-ToF of Intact Protein: Survey Spectrum

  16. ESI-ToF of Intact Protein: Deconvolution Results

  17. MALDI ESI-ToF of Intact Protein: Deconvolution Results Multiple Phosphorylations (7 predicted) Average mass peak

  18. ESI-ToF of Intact Protein: Deconvolution Evidence (Average Mass Peak)

  19. MS-ToF Of Large Intact Protein (Agilent 6220) • Agilent 6220 ToF • mass accuracy: <2 ppm • Resolution 20,000 • Up to 10 spectra/second • M/z range of 25 to 20,000 • New MassHunter Workstation • Integrated deconvolution and molecular feature extraction

  20. TIC of Large Intact Protein

  21. ESI-ToF of Large Intact Protein: Survey Spectrum

  22. ESI-ToF of Intact Protein: Deconvolution Results Predicted average mass: 82958.07

  23. ESI-ToF of Intact Protein: Deconvolution Results (2)

  24. Case Studies (2) Sequence Confirmation and Disulfide Linkage Mapping

  25. Experimental conditions • 947-residue fusion protein, requiring sequence confirmation with disulfide linkages mapped • Sample split, one aliquot reduced/alkylated, other alkylated only, followed by proteolytic digest of reduced and non-reduced preps (trypsin/endo-Lys-C) • Injection of 3-5 µg of proteolytic digest over analytical C18 (reversed phase) • 180 min. linear gradient, 200 µL/minute flow rate • 100-3200 m/z acquisition range, 215, 254, 280 nm UV • Deconvolution of peptides and sequence matching via BioConfirm with <5 ppm mass accuracy

  26. Fusion protein peptide map UV chromatogram (overlay)

  27. Fusion protein predicted disulfide linkages and associated tryptic peptides AA(1-28) + AA(35-59) ALC3GGELVDTLQFVC15GDRGFYFSRPASR + GIVEEC40C41FRSC45DLALLETYC54ATPAK - readily detected in non-reduced sample AA(72-91) + AA(102-109) AVPTQC77DVPPNSR*FDC87APDK + GC103C104YIPAK - only detected with Arg to Ser point mutation at Arg84 AA(92-101) + AA(110-132) AITQEQC98EAR + QGLQGAQMGQPWC122FFPPSYPSYK • linkage not detected

  28. AA(1-28) + AA(35-59) ALC3GGELVDTLQFVC15GDRGFYFSRPASR + GIVEEC40C41FRSC45DLALLETYC54ATPAK AA(523-580) GSEDGC528PNNELENPPYVPGVVGGTLQAATIC553ASSHQFLSTHYNLHNLYGLTEAIASHR AA(604-655) YAGHWTGDVWSSWEQLASSVPEILQFNLLGVPLVGADVC642GFLGNTSEELC653VR - all linkages readily detected in non-reduced sample Fusion protein identified disulfide linkages and associated tryptic peptides

  29. Fusion protein non-reduced peptide mapPeptides ALCGGELVDTLQFVCGDRGFYFSRPASR + GIVEECCFRSCDLALLETYCATPAK[residues 1-28 + 35-59] at retention time 109.9494molecular mass: 5791.7 Daltons (three disulfide linkages detected) (M+4H)+ (M+3H)+

  30. Fusion protein non-reduced peptide mapPeptides ALCGGELVDTLQFVCGDRGFYFSRPASR + GIVEECCFRSCDLALLETYCATPAK [residues 1-28 + 35-59] 4+ charge state displayedmolecular mass: 5791.7 Daltons (three disulfide linkages detected)

  31. Case Studies (3) • Relative quantitation of methionine oxidation

  32. Experimental conditions • Client requires quantitation of methionine oxidation on three residues to release product (650-residue<<check this, not exact>> monoclonal Ab) • Sample reduced and digested using endo-Lys-C • Injection of 5 µg proteolytic digest over analytical C18 (reversed phase) • 40 min. linear gradient, 200 µL/minute flow rate • 100-3200 m/z acquisition range, 215 nm UV • Deconvolution of peptides and sequence matching via Qualitative Data Analysis with <5 ppm mass accuracy • Relative quantitation using “volume” of deconvoluted oxidized and non-oxidized peptide peaks via BioConfirm

  33. Monoclonal Ab digest UV chromatogram oxidated Non-oxidated

  34. Oxidated peptide spectra

  35. Non-oxidated peptide spectra

  36. Compound detection by Qualitative Data Analysis

  37. Sequence Matching results

  38. Quantitation Results

  39. Acknowledgements/Contact Info

  40. Blue Stream LaboratoriesContact Information • Contact • Email • Mario DiPaola PhD / MBA • CSO/COO • William C Rash • VP Business Development • mdipaola@bluestreamlabs.com • Brash@bluestreamlabs.com

More Related