130 likes | 144 Vues
Hox Genes Control the Vertebrate A-P Axis. Homeodomain protein. A homeobox is about 180 base pairs long and encodes a protein domain that binds DNA with the nucleotide sequence TAAT.. RRRKRTA-YTRYQLLE-LEKEFLF NRYLTRRRRIELAHSL-NLTERHIKIWFQNRRMKWKKEN. The modular construction of plants.
E N D
Homeodomain protein • A homeobox is about 180 base pairs long and encodes a protein domain that binds DNA with the nucleotide sequence TAAT.. • RRRKRTA-YTRYQLLE-LEKEFLF NRYLTRRRRIELAHSL-NLTERHIKIWFQNRRMKWKKEN
The size of the meristem is controlled by a self-regulating balance between a short-range stimulatory signal produced by cells expressing Wuschel(yellow arrow), and a longer-range inhibitory signal delivered by Clavata3 (red bars).
A Hierarchy of Inductive Interactions Subdivides the Vertebrate Embryo
http://www.nature.com/nrm/journal/v7/n4/extref/nrm1855-s1.avihttp://www.nature.com/nrm/journal/v7/n4/extref/nrm1855-s1.avi