'Cleavage site' diaporamas de présentation

Proteomics & Mass Spectrometry

Proteomics & Mass Spectrometry. Nathan Edwards Center for Bioinformatics and Computational Biology. Outline. Proteomics Mass Spectrometry Protein Identification Peptide Mass Fingerprint Tandem Mass Spectrometry. Proteomics. Proteins are the machines that drive much of biology

1.85k views • 65 slides

Introduction to Avian Influenza

Introduction to Avian Influenza. David L. Suarez D.V.M., Ph.D. Research Leader Exotic and Emerging Avian Viral Disease Research Unit Agricultural Research Service United States Department of Agriculture. Influenza A Virus Negative sense RNA Single stranded Segmented

689 views • 46 slides

Compartments in the eukaryotic cell

Compartments in the eukaryotic cell. Protein targeting/localization signals. Signal peptide Mitochondrial targeting peptide Chloroplast targeting peptide LPxTG sorting signal Peroxisomal targeting signal (PTS2) Signal anchor Nuclear localization signal ER/Golgi retention signal

643 views • 43 slides

Hidden unit weights in network model correlations

Hidden unit weights in network model correlations. Compartments in the eukaryotic cell. Protein targeting/localization signals. Signal peptide Mitochondrial targeting peptide Chloroplast targeting peptide LPxTG sorting signal Peroxisomal targeting signal (PTS2) Signal anchor

541 views • 42 slides

EXPERIMENT OBJECTIVE:

EXPERIMENT OBJECTIVE:. The objective of this experiment is to develop an understanding of DNA mapping by determining restriction enzyme cleavage sites on a circular DNA plasmid. BRIEF DESCRIPTION OF EXPERIMENT:.

591 views • 41 slides

521 views • 39 slides

Man-Wai MAK and Wei WANG The Hong Kong Polytechnic University Sun-Yuan KUNG Princeton University

Truncation of Protein Sequences for Fast Profile Alignment with Application to Subcellular Localization. Man-Wai MAK and Wei WANG The Hong Kong Polytechnic University Sun-Yuan KUNG Princeton University. Contents. Introduction Cell Organelles and Proteins Subcellular Localization

434 views • 28 slides

Botulinum toxin in Ophthalmic Practice

Botulinum toxin in Ophthalmic Practice . Dr Sunayana Bhat Consultant Paediatric ophthalmology , Strabismus and Neuro ophthalmology Vasan eye care , Mangalore Ph : 9611102754 chanyn9@gmail.com. Botulinum toxin injections are the fastest-growing cosmetic procedure all over the world

647 views • 26 slides

Justin Choo, Tin Wee Tan, Shoba Ranganathan

Justin Choo, Tin Wee Tan, Shoba Ranganathan. A comprehensive assessment of N-terminal signal peptide prediction methods. Targeting of secretory proteins.

260 views • 25 slides

Characterization of the H7N3 Viruses Isolated During the BC

Characterization of the H7N3 Viruses Isolated During the BC Avian Influenza Outbreak. John Pasick, DVM, MSc, PhD Canadian Food Inspection Agency National Centre for Foreign Animal Disease Winnipeg, Manitoba. NA. HA. PB1. PB2.

380 views • 24 slides

Characterization of the H7N3 Viruses Isolated During the BC

Characterization of the H7N3 Viruses Isolated During the BC Avian Influenza Outbreak. John Pasick, DVM, MSc, PhD Canadian Food Inspection Agency National Centre for Foreign Animal Disease Winnipeg, Manitoba. NA. HA. PB1. PB2.

324 views • 24 slides

PINK1 cleavage at position A103 by the mitochondrial protease PARL

PINK1 cleavage at position A103 by the mitochondrial protease PARL. Emma Deas , Helene Plun-Favreau , Sonia Gandhi, Howard Desmond, Svend Kjae , Samantha H.Y. Loh , Alan E.M. Renton, Robert J. Harvey, Alexander J. Whitworth, L. Miguel Martins, Andrey Y. Abramov and Nicholas W. Wood

310 views • 24 slides

Expression of clones genes

Expression of clones genes. a.o. Primrose & Twyman, 7th edition, pp.81-93 Primrose, Twyman & Old, 6th edition, pp.70-83. IPTG-induced expression of RP4 proteins : (A) DNA primase (118 and 80 kDa proteins) ; (B) 16.5 and

481 views • 23 slides

Advanced Medicinal Chemistry

Advanced Medicinal Chemistry. Lecture 1:. Target Classes. Dr Jeff Stonehouse AstraZeneca R&D Charnwood. The Drug Discovery Process. 3 months to 2 years!. Target Identification. HTS. 3-4 months. Active-to-Hit (AtH). 3 months. Hit-to-Lead (HtL). 6-9 months. New Lead Optimisation

1.05k views • 19 slides

Avian Influenza Initiatives Canadian Food Inspection Agency Dr. Daniel Schwartz

Avian Influenza Initiatives Canadian Food Inspection Agency Dr. Daniel Schwartz. CFIA Avian Influenza Initiatives. Reportable Disease Response Priority Protect animal health, human health, economy. Dedicated Resources National AI Working Group Federal: AAFC, CBSA, PHAC, HC, EC

321 views • 16 slides

Working Group One: Influenza Virulence and Antigenic Change Research Recommendations

John R. LaMontagne Memorial Symposium on Pandemic Influenza Research April 4-5, 2005 Institute of Medicine. Working Group One: Influenza Virulence and Antigenic Change Research Recommendations. Defining the loci for pathogenicity (Combined Q1 and in part Q4)

219 views • 6 slides

Working Group One: Influenza Virulence and Antigenic Change Research Recommendations

John R. LaMontagne Memorial Symposium on Pandemic Influenza Research April 4-5, 2005 Institute of Medicine. Working Group One: Influenza Virulence and Antigenic Change Research Recommendations. Defining the loci for pathogenicity (Combined Q1 and in part Q4)

67 views • 6 slides

MVKFLFSVIILFFLLSAVGSSA RNIEEDGVIRLPSEVKDFINGKN IDDDSVGGTRWAVLI 60

Bosch et al. Supplemental Figure 1A. Predicted amino acid sequence of Papaver pollen VPE. MVKFLFSVIILFFLLSAVGSSA RNIEEDGVIRLPSEVKDFINGKN IDDDSVGGTRWAVLI 60 AGSSGYWNYRHQADVCHAYQVLKRGGVKDENIVVFMYDDIALNEENPRPGVIINHPKGED 120 VYAGVPKDYTGRDVTAHNFYSVLLGNKTAVKGGSGKVIDSGPNDHIFIYYSDHGGPGVLG 180

112 views • 3 slides

Mammalian mRNA Polyadenylation Machinery

Mammalian mRNA Polyadenylation Machinery.

108 views • 2 slides