'Start codon' diaporamas de présentation

CMSC 150 Loops

814 views • 74 slides

Figure 16.0 Watson and Crick

734 views • 52 slides

RNA processing in eukaryotes

4.07k views • 45 slides

Vocabulary Review

Vocabulary Review . Nucleic Acids. Enzyme that unwinds & separates the DNA strands. Helicase. Double helix shape. DNA. Base with a double carbon-nitrogen ring. Purine. Change in a DNA nucleotide sequence. Mutation. Copies DNA and carries the code to the cytoplasm. mRNA. AUG.

511 views • 39 slides

Why is proper protein production so important?

443 views • 34 slides

KEY CONCEPT DNA structure is the same in all organisms.

KEY CONCEPT DNA structure is the same in all organisms. We love D N A Made of nucleotides Sugar, Phosphate and a Base Bonded down one Side. Adenine and Thymine Make a Lovely Pair Cytosine without Guanine Would feel very bare. O-O-O deoxy-ribo-nucleic acid R-N-A is ribo-nucleic acid.

416 views • 30 slides

Gene Prediction

399 views • 29 slides

Annotating a Gene Do I Have the Whole Gene?

Annotating a Gene Do I Have the Whole Gene?. Planctomyces limnophilus imidazole glycerol phosphate synthase subunit hisF VKGVNFLNLQDAGDPVEVAARYERDGADELVFLDITASHEERGIIHDVVR RTSEVCFMPLTVGGGIRNLDDIRTLLQAGCDKVSINSAAVKDPEFVRAAA LKFGKQCIVVNIDPRRVTQPDGSVKWEVHINGGRKPTGLEAVSWAKEVER

355 views • 27 slides

Part 2: Molecular Biology

Part 2: Molecular Biology. IGEM, 20 June 2006. Proteins. Structural and catalytic components of cells are mainly proteins. Linear polymers of 20 different amino acids joined by amide linkages. Spontaneously fold into 3D shapes (tertiary structure).

382 views • 25 slides

KEY CONCEPT Translation converts an mRNA message

1.11k views • 21 slides

How to annotate a gene ?

375 views • 20 slides

Mutations of the alternate start signal for the Galls protein in Agrobacterium rhizogenes

338 views • 20 slides

JIGSAW: a better way to combine predictions

JIGSAW: a better way to combine predictions. J.E. Allen, W.H. Majoros, M. Pertea, and S.L. Salzberg. JIGSAW, GeneZilla, and GlimmerHMM: puzzling out the features of human genes in the ENCODE regions. Genome Biology 2007, 7(Suppl):S9.

361 views • 16 slides

Translation Translation

506 views • 16 slides

Experiment: Protein Synthesis

Experiment: Protein Synthesis. Modelling the structure of DNA and the process of protein synthesis. Equipment. 42 toothpicks 18 milk bottles, cut in half 18 raspberry lollies, cut in half 25 jelly beans, cut in half (5 each of 5 colours) 4 jelly snakes (approx . 6cm in length) Sharp knife

206 views • 9 slides

A Tale of Three Gene Annotations

A Tale of Three Gene Annotations. Nick Carney. JGI Gene 2500587691. RAST/SEED. JGI. Manatee. The SEED. Manatee. JGI. Manatee. The SEED. JGI. Shine-Delgarno?. No Shine-Delgarno sequence immediately in front of start codons

162 views • 8 slides

trpC Gene Annotation in Thiomicrospira crunogena

trpC Gene Annotation in Thiomicrospira crunogena. Phosphoribosylanthranilate Isomerase. 639 bp 212 aa.

156 views • 5 slides

Anticodon

Cytoplasmic membrane. 1. fMet. C. A. U. Anticodon. mRNA. Start codon. A. U. G. U. U. U. A. C. G. 5 ?. 3 ?. P. A. Small ribosomal subunit. GTP. GDP. P. Cytoplasmic membrane. 1. 2. fMet. fMet. tRNA fMet. +. C. A. U. Anticodon. mRNA. Start codon. U. A. A. A.

174 views • 3 slides

Shine-Dalgarno

522 views • 1 slides

Darin Scribner, Santiago Morales, Shady Hamdallah

176 views • 1 slides