Gabriel
Uploaded by
22 SLIDES
621 VUES
220LIKES

CTCF and Imprinting Disorder

DESCRIPTION

CTCF and Imprinting Disorder. Preeti Misra Sang-Gook Han. Contents. Interesting Protein and Diseases. Background. Gene Network. Properties of CTCF. Epigenetic - Acetylation - Methylation. Pathway - CTCF. Human diseases. Loss of Imprinting. U(t). Y(t). +. C(t). P(t).

1 / 22

Télécharger la présentation

CTCF and Imprinting Disorder

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. CTCF and Imprinting Disorder Preeti Misra Sang-Gook Han

  2. Contents Interesting Protein and Diseases Background • Gene Network • Properties of CTCF • Epigenetic • - Acetylation • - Methylation • Pathway - CTCF • Human diseases • Loss of Imprinting

  3. U(t) Y(t) + C(t) P(t) + - H(t) Background: Gene Network • Activation and Inhibition with evolution Control: Achieve an objective of the system Survival, reproduction

  4. Background: Epigenetic Epigenetic : Surface of genetic Gene expression control without modification of DNA sequence. • Histone Modification • Acetylation • Methylation DNA Methylation - Methylation of Cystosine(C). - CpG island Expansion Condensation

  5. Background: Epigenetic

  6. DNA Methylation • Post-synthetic modifications of Chromatin structure • Cytosine-Guanine (CG) base pair is methylated. • Regulation in gene expression.

  7. Background: Loss of epigenetic marks.

  8. Background: Genomic Imprinting DMR: Differentially Methylated Region ICR: Imprinting Control Region father mother

  9. CTCF Protein • Gene location: 16q22 • 11 zinc fingers. • Transcription Binding Factor : (MYC, PLK, PIM-1, p19ARF, and Igf2/H19, APPβ,β-globin, and lysozyme regulatory sequences ) • Binding to TFBSs including ICR and CpG island. • Cis-regulartory. • Regulation of DNA methylation pattern • Highly conserved. • There are 39,622 ZnFg registered in pFam

  10. CTCF motif

  11. CTCF Structure Classification and GO

  12. CTCF Protein : C2H2 type C - x(2,4) - C - x(3) - [LIVMFYWC] - x(8) - H - x(3,5) – H GSSGSSGRTHTGEKPYACSHCDKTFRQKQLLDMHFKRYHDPNFVPAAFVCSKCGKTFTRRNTMARHADNCAGPDGVEGENSGPSSG

  13. CTCF and its Uses • CTCF is involved in the control of cell growth and differentiation. • Involved in IGF2 imprinting regulation. • CTCF may represent a novel tumor suppressor gene that displays tumor-specific "change of function" rather than complete "loss of function“. • CTCF may establishes a regulatable epigenetic switch for X-inactivation

  14. Human Disease: Beckwith-Wiedemann syndrome BWS locus: 11p15.5 BWS occurs in 1:13,700 Phenotypes: 1. Macroglossia: Problem with Eating, Breathing, speaking 2. Abdominal wall defects 3. Fast growth: birth weight and height (above mean) enlarge internal organs (kidneys, liver,pancreas) hemihyperplasia 4. Ear lobe

  15. Pathway : BWS BWS Tumor Wilms’ Tumor CTCF Inhibit the enhancer from activating IGF2(Insulin-like Growth Factor 2) and causes H19 to be expressed.

  16. Mutation ZF3 ZF3 ZF3 ZF7

  17. Other Diseases • Prader-Willis Syndrome(PWS)-failure to thrive during infancy and hyperphagia. • Angelman syndrome(AS)- mental retardation and speech impairment • Transient neonatal diabetes mellitis(TNDM)-a rare form of diabetes • Alpha-thalassemiaoccurs(males)- mental retardation syndrome.

  18. Capta

  19. Capta

  20. Catpa

  21. Reference • http://www.benbest.com/health/cancer.html • http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10664 • Marcus Vinicius de Matos Gomes; Ester Silveira Ramos (2003), Beckwith-Wiedemann syndrome and isolated hemihyperplasia, Sao Paulo Med J. 21, 133-138 • Keith D. Robertson (2004), DNA Methylation and Human Disease, Nature, 6, 597-610 • Galina N. Filippova, et. al. (2002), Tumor-associated Zinc Finger Mutations in the CTCF Transcription Factor Selectively Alter Its DNA-binding Specificity, Cancer Research, 62, 48-52

  22. Question Time!!!!

More Related
SlideServe
Audio
Live Player
Audio Wave
Play slide audio to activate visualizer