Download
requirement elicitation n.
Skip this Video
Loading SlideShow in 5 Seconds..
Requirement Elicitation PowerPoint Presentation
Download Presentation
Requirement Elicitation

Requirement Elicitation

294 Vues Download Presentation
Télécharger la présentation

Requirement Elicitation

- - - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript

  1. Requirement Elicitation AyuManikDirgayusariS.Kom, M.MT

  2. Apa itu Problem Domain? Bagian dari seluruh bidang pemecahan masalah analisa spesifikasi desain Problem domain Solution sistem interface • Analisa concern pada domain permasalahan dan pemecahan permasalahan • Spesifikasi concern pada interaksi antara domain problem dan solusi sistem • Desain (bukan bagian dari rekayasa kebutuhan) concern terhadap pekerjaan internal dari solusi sistem

  3. Contoh Kebutuhan Contoh kebutuhan untuk sistem perpustakaan • Sistemdapatmengelolacatatandariseluruh material perpustakaanseperti: buku, korandanmajalah, video dan tape audio, laporan, koleksitransparan, disket, dan CR-ROM • Sistemakanmengijinkan user untukmencari item tertentumelaluijudul, pengarangatau ISBN • Antarmuka user padasistemakandiimplementasikanmenggunakan WWW browser • Sistemharusmendukung paling sedikit 20 transaksi per detik • Fasilitassistemuntukpublik yang tersediaharusdapatdidemontrasikandalam 10 menitataukurang.

  4. Problem pada Kebutuhan • Kebutuhan tidak merefleksikan the real needs dari customer pada sistem • Kebutuhan tidak konsisten dan/atau tidak komplit • Sangat mahal untuk merubah kebutuhan setelah mereka menyetujuinya • Ada perbedaan pemahaman antara customer, pengembang kebutuhan sistem dan pengembang rekayasa software atau pemelihara sistem.

  5. Apa itu Kebutuhan? Kebutuhan dapat menggambarkan • Fasiltas dari sebagian user (contoh: ‘Word processor ini harus memiliki perintah spell checking dan correction’) • Sifat sistem yang sangat general (contoh: ‘sistem harus menjamin setiap informasi pribadi yang tersedia harus melalui authorisation’) • Batasan spesifik pada sistem (contoh: ‘sensor harus disediakan 10 kali dalam setiap detik’) • Bagaimana menyelesaikan beberapa perhitungan (contoh: ‘total nilai dihitung berdasarkan penjumlahan nilai ujian, proyek dan tugas mahasiswa dengan rumus ‘nilai total = ujian + 2 * proyek + 2/3 * tugas’) • Batasan pada pengembangan sistem (contoh: ‘sistem harus dikembangkan dengan Ada’)

  6. Ringkasan Klasifikasi Kebutuhan User

  7. Proses Rekayasa Kebutuhan • Pendataan • Analisa • Spesifikasi • Human machine interface (HMI) design • Validation

  8. Pendataan Fokuspadapengambilaninformasi, termasukjugapengetahuantentangpengambilankebutuhan, capture kebutuhandisebutrequirement acquisition. Ada 3 halutama: • Informasiapa yang mestidiambil? • Dari sumberapauntukbisamenggalinya? • Bagaimanamekanismedanteknikdalampengambilan data?

  9. Analisa Sebuah konsep yang rumit, tentu saja penuh akal, sebagaimana yang dilakukan dalam • Analisa dari dokumen kebutuhan untuk sistem • Penetapan dasar, solusi prilaku sistem • Pengembangan tingkat tinggi, desain arsitektural untuk solusi sistem

  10. Analisa Menekankan pada karakteristik-karakteristik yang penting, seperti: • Domain problem, BUKAN solusi sistem • Mendapatkan pemahaman yang wajar tentang permaslahan dan bagaimana memecahkannya • Analisa mendahului spesifikasi

  11. Spesifikasi Didefinisikan untuk menemukan dan menentukan prilaku dari solusi sistem sebagaimana hasil dari pengaruh kebutuhan dalam domain permasalahan. Spesifikasi juga disebut: • Spesifikasikebutuhan • Spesifikasikebutuhansistem • Definisikebutuhan • Definisikebutuhanfungsional • Dan lain-lain

  12. HMI (Human Mechine Interface) Perinciandesaineksternal yang besar yang dipisahkandarispesifikasi. Intiprilakudarisistembaru yang didesaindanditentukandalamspesifikasitetapidesainnya low-level detail (look and fell)

  13. Validation Prosesterakhiruntukmengecekkebutuhansistem yang akandiimplementasikan agar dapatdinyatakandalamdiskripsi yang dapatditerimaoleh customer

  14. pre-existing system user etc Client CSR ‘raw’ requirement, PD detail, etc. Questions, prompts elicitation Understanding question Suggested new system behaviour Elicited information HMI design PD detail + requirement elicitation note +questions analysis Client specified behaviour + constraints Outline behaviour Understanding specification HMI specification PD detail + requirement New system behaviour HMI specification document specification document requirement document New system behaviour HMI specification PD detail + requirement internal design Diagram Proses Rekayasa Kebutuhan

  15. Dokumen Kebutuhan Menggambarkan • Servis dan fungsi yang disediakan oleh sistem • Constrain yang harus dipenuhi untuk mengoperasikan sistem • Keseluruhan properti sistem. Misalnya batasan pada properti emergency sistem • Difinisi dari sistem lain yang terintegrasi dengannya • Informasi tentang aplikasi dari sistem. Misal bagaimana perhitungan tertentu dapat dilakukan sistem • Batasan dari proses yang digunakan dalam pengembangan sistem

  16. PENDATAAN

  17. Pengertian Pendataan • Sebuah nama yang diberikan pada aktifitas yang rumit dalam menemukan kebutuhan sistem • Pengembang & engineer sistem bekerja sama dengan customer & end-user untuk mencari problem yang akan dipecahkan, servis dari sistem, kebutuhan kinerja dari sistem, batasan hardware dan lain-lain. • Merupakan proses yang komplek. Customer jarang mempunyai gambaran yang jelas tentang kebutuhan mereka, banyaknya orang di organisasi sangat berpotensi menjadikan konflik kebutuhan, selalu ada keterbatasan teknologi, dan lain lain. • Guna untuk memahami secara detail dari problem tertentu yang membutuhkan solusi sistem.

  18. 4 Dimensi Kebutuhan Pendataan Requirement elicitation Application domain Problem to be solved Stakeholder need & constraints Business context

  19. 4 Dimensi Kebutuhan Pendataan • Pemahaman domain aplikasi • Pengetahuanumumdarisistem yang akandiimplementasikan. Contoh: pemahamankebutuhanuntuksistemkatalog, pengetahuanumumperpustakaandanbagaimanaperpustakaanbekerja; • PemahamanPermasalahan • Detail daripermasalahan customer dimanasistemakandiimplementasikan. Olehkarenanyauntuksistemkatalog, harusmemahamibagaimanaorganisasiperpustakaanmengkoleksiitemnya.

  20. 4 Dimensi Kebutuhan Pendataan • PemahamanBisnis • Secaraumumsistemakanmemberikankontribusiuntukpengembanganbisnisatauorganisasi. Dengandemikianharusdiketahuibagaimanasistemberinteraksidanmempengaruhibagian yang berbedapadabisnisdanbagaimanadapatberperanuntukmencapaitujuansecarakeseluruhan. • Pemahamankebutuhandanbatasansistemdari stakeholder • Stakeholder merupakanorang-orang yang akanmempengaruhijalannyasistem. Merekamungkin end-user sistem, manajerdepartemendimanasistemdiintalasi, dll. Karenaitulahharussecara detail diketahuispesifikasikebutuhannyauntukmendukungjalannyasistem. Prakteknyaharusmemahamiproseskerjauntukmendukungdanmengatursistem yang ada.

  21. Strategi Pendataan • Informasi apa yang mesti diambil? • Dari sumber mana bisa menggalinya? • Bagaimana mekanisme dan teknik dalam pengambilan data? • Pertimbangan socio-political • Disagreement dan negoisasi requirements • Requirements yang berkembang

  22. Informasi yang di data Dalammenentukaninformasi yang akandigali, harusdiperhatikan domain permasalahan yang dihadapidanjugasumber-sumbermanasaja (yang terkaitdengan domain permasalahan) yang dapatmemberikaninformasi.

  23. Informasi yang di data • Pada awalnya informasi yang bisa didapat hanya sedikit, tetapi sangat membantu untuk menentukan tujuan dari setiap sesi pendataan. Informasi awal yang perlu diperoleh: • Tipe dasar aplikasi • Identifikasi client • Motivasi utama pengembangan • Dan lain-lain

  24. Informasi yang di data • Selain informasi awal pada slide sebelumnya. Informasi lain yang perlu didapat adalah: • Deskripsi problem domain • List problems dan kebutuhan • Saran user tentang batasan-batasan/struktur dari sistem atau solusi permaslahan Catatan: Informasi-informasi tersebut di atas akan digunakan dalam penyusunan dokumen kebutuhan dan dokumen spesifikasi

  25. Sumber Informasi • Diantaranya: • Clients • Client's specifications • Sistem yang telah ada sebelumnya • User sistem yang telah ada sebelumnya • User potensial sistem yang akan dibangun • Produk yang pernah dibuat sebelumnya (developer) • Produk competitor • Para pakar software aplikasi • Terminator • Standar-standar teknik yang relevan

  26. Pengaruh Socio-Cultural Dalam melakukan pendataan perlu diperhatikan beberapa aspek socio-cultural, yaitu aspek yang berhubungan dengan orang-orang yang terlibat dalam proses pendataan, yaitu: • Kejujuran sumber informasi. • Faktor-faktor psikologis. • Pengaruh kekuasaan.

  27. Disagreement & Negosiasi Requirement Dalamprosespenyusunankebutuhandapatterjadiketidakcocokanantara user atau stakeholder dengankebutuhansistem yang akandibangun, makadiperlukanadanyasuatunegoisasiantara developer dengan stakeholder sistembarutersebut, yang dikenalsebagai ‘requirements negotiation’

  28. Requirement yang berkembang Dalam pengembangan sistem, terkadang kebutuhan sistem berubah atau berkembang. Keadaan ini perlu diperhatikan juga dalam proses pendataan, agar tidak terjadi misunderstanding bagi pengembang sistem

  29. Komponen Sistem Informasi

  30. Komponen Sistem Informasi • Sistem informasi dapat digambarkan sebagai sistem yang terdiri dari berbagai komponen • Komponen ini dapat dianalogikan sebagai blok bangunan (building block), yang terdiri dari: - Blok masukan (input block) - Blok model (model block) - Blok keluaran (output block) - Blok teknologi (technology block) - Blok basis data (database block) - Blok kendali (control block) (Burch & Grudnitski)

  31. User User Input Model Output User User Technology Database Control User User Komponen Sistem Informasi • Berbagai blok tsb saling berinteraksi satu sama lain membentuk satu kesatuan untuk mencapai sasarannya (Burch & Grudnitski)

  32. Komponen Sistem Informasi • Blok masukan (input block) Mewakili sejumlah data yang masuk ke dalam sistem informasi. Input termasuk pula metode-metode dan media untuk memperoleh data yang akan dimasukan, dapat berupa dokumen-dokumen dasar • Blok model (model block) Terdiri dari kombinasi prosedur, logika, dan model matematika yang akan memanipulasi data input dan data yang tersimpan di database dengan cara tertentu untuk menghasilkan keluaran (ouput) yang diinginkan.

  33. Komponen Sistem Informasi • Blok keluaran (output block) Produk dari system informasi adalah keluaran yang merupakan informasi dan dokumentasi yang dapat digunakan untuk semua tingkatan manajemen dan semua pemakai sistem • Blok teknologi (technology block) Teknologi merupakan ‘tool-box’ dalam sistem informasi. Teknologi digunakan untuk menerima input, menjalankan model, menyimpan dan mengakses data, menghasilkan dan mengirimkan keluaran dan membantu pengendalian dari system secara keseluruhan. Teknologi terdiri dari 3 bagian utama, yaitu: aspek manusianya (brainware), perangkat lunak (software), dan perangkat keras (hardware).

  34. Komponen Sistem Informasi • Blok basis data (database block) Database merupakankumpulandari data yang salingberhubungansatusamalainnya, tersimpanpadaperangkatkeraskomputerdandigunakanperangkatlunakuntukmemanipulasinya. Pengelolaan database umumnya dikenal dengan nama DBMS (Database Management System). • Blok kendali (control block) Bagian pengendalian dirancang dan diterapkan untuk memelihara system dari hal-hal yang dapat merusaknya, seperti faktor-faktor alamiah (temperatur, air, api, debu, dsb), virus, sabotase/hijacking, dan sebagainya.

  35. Komponen Sistem Informasi Komponen Sistem Informasi Berbasis Komputer • Pada dasarnya pemrosesan data dalam sistem informasi berbasis komputer terdiri dari lima komponen, yaitu: - Hardware - Software - Brainware - Procedures - Database • Setiapelemenmerupakansuatukesatuan yang terpaduuntukmenghasilkankeluaranatau output (misalnyauntukprosestransaksiatauprosespengambilankeputusan).

  36. Komponen Sistem Informasi • Hardware Istilah hardware umumnyadigunakanuntukmenggambarkanmesin, alat(devices),danperalatan(equipment) yang berkaitandenganpengolahan data. Hardware digunakanuntukmenunjukkanfungsipenyiapan data, input data, perhitungan, penyimpanandanmenampilkankeluaran (ouput). Hardware dalamkontekssisteminformasiseringkalidiidentikandengankomputer

  37. Secondary Storage: Magnetic disk Magnetic tape Optical disk Central Processor: CPU: - Arithmetic-Logical Unit - Control Unit Primary Storage • Input Device: • Keyboard • Optical reader • Magnetic reader • Voice input device • Pointing device • Output Device: • Display / monitor • Printer • Plotters • Voice output device • Microfilm • Communication Device: • Cluster control unit • Modem • Multiplexer • Telephone • Channel Komponen Sistem Informasi

  38. Komponen Sistem Informasi • Software Software atau perangkat lunak merupakan sejumlah instruksi untuk mengendalikan operasi dari system computer untuk pemrosesan, digunakan untuk mengelola sumber daya computer. Tanpa software, hardware computer tidak dapat menjalankan tugasnya Fungsi software: Mengelolasumberdayakomputer Menyediakansaranabagipenggunauntukmemanfaatkansumberdayatsb. Sebagaiperantaraantarainformasi yang disimpandenganpenggunanya (individu/organisasi)

  39. Komponen Sistem Informasi • Brainware Brainware adalah manusia yang terlibat secara langsung dengan pengelolaan komputer McLeod menyatakan bahwa suatu organisasi atau perusahaan yang menggunakan sistem informasi berbasis komputer harus menyadari perlunya membentuk unit organisasi yang terdiri dari para spesialis yang bertanggung jawab dalam menerapkan dan menjalankan system informasi tersebut.

  40. Komponen Sistem Informasi • Procedures Prosedur adalah serangkaian peraturan-peraturan yang menentukan operasi sistem komputer Prosedur juga dapat diartikan sebagai kebijakan perusahaan yang mengendalikan operasi sistem komputer. Misalnya; tahapan yang harus dilakukan pemakai untuk memasukan password dan log-in pada jaringan komputer, peraturan bahwa setiap transaksi dalam divisi tertentu harus tercatat dalam database komputer, dsb Dalam suatu organisasi/perusahaan biasanya terdapat standar operating procedures (SOP) yang menjelaskan aktivitas normal harian dan penanganan hal-hal yang sifatnya darurat bila terjadi kesalahan/kerusakan perangkat lunak ataupun keras.

  41. Komponen Sistem Informasi • Database Database merupakan kumpulan file-file yang berisi data yang saling berhubungan dan terorganisir, terpadu, diatur dan disimpan menurut suatu cara tertentu yang memudahkan proses pengambilan kembali Sedangkan database system adalah sejumlah perangkat keras dan lunak komputer serta pemakai yang secara terpadu bekerja menggunakan kombinasi dari database, paket database, manajemen dan pengguna lainnya.

  42. Sistem Informasi dan Organisasi • Sistem informasi pada dasarnya merupakan bagian/komponen dari organisasi, oleh karena itu komponen-komponen sistem informasi juga merupakan komponen dari organisasi • Dalam suatu organisasi sistem informasi merupakan suatu alat yang dapat memberikan informasi yang diperlukan kepada semua pihak yang berkepentingan

  43. Sistem Informasi dan Organisasi • Demikian pula sebaliknya, biladiperluas, dilihatdarisudutpandang/konseporganisasi, komponenorganisasiadalahjugakomponensisteminformasi • Komponendalamsuatuorganisasidapatberupa: - Tempatkerja (workplace) - SDM operasional - Budayaorganisasi - Kekayaan (asset) - Pengaruh

  44. Sistem Informasi dan Organisasi • Tempat kerja (workplace) merupakan tempat di mana SDM membuat dan memasarkan produk & jasa • SDM operasional Merupakan SDM yang berhubungan langsung dengan proses produksi & distribusi (di luar SDM Informasi/ Brainware) • Budaya organisasi Merupakan cara-cara yang dilakukan oleh para anggota/karyawan dalam suatu organisasi yang dapat menjadi perekat sosial di dalam organisasi tersebut

  45. Sistem Informasi dan Organisasi • Kekayaan (asset) tangible asset: mesin, peralatan, uang,dsb, intangible asset: paten, hak cipta, dsb • Pengaruh pengaruh timbal balik yg terjadi antara perusahaan dengan lingkungannya merupakan akibat dari adanya interaksi terus menerus

  46. Ringkasan Komponen Sistem Informasi