ady
Uploaded by
1 SLIDES
172 VUES
10LIKES

Web Services for PIR/UniProt Databases

DESCRIPTION

iProClass. PIRSF. UniProt. Web Services Layer. Client. Business Layer. Data Layer. HTTPD. JSP/ Servlets Struts. Protein ID Peptide/Protein Sequence Mapping. Integrated Data at VBI. Master Catalog & Complete Proteomes at GU-PIR. Domain Objects. SOAP Messages. SOAP Client.

1 / 1

Télécharger la présentation

Web Services for PIR/UniProt Databases

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript

Playing audio...

  1. iProClass PIRSF UniProt Web Services Layer Client Business Layer Data Layer HTTPD JSP/ Servlets Struts Protein ID Peptide/Protein Sequence Mapping Integrated Data at VBI Master Catalog & Complete Proteomes at GU-PIR Domain Objects SOAP Messages SOAP Client Query Processor Database DAO ORM JDBC SOAP Engine Data Exchange Format Controlled Vocabulary Ontology Message Processor <WSDL /> UniProt Standards and Interoperability Multiple Data Types from Proteomics Research Centers • Annotation Standards • Annotation Guides • Controlled Vocabularies and Ontologies • Evidence Attribution Mechanism • Data Submission and Exchange Standards • Sequence, Annotation, Bibliography Submission • Reciprocal Links, Database Cross-References • Dissemination • Databases: XML/DTD, Flat File, FASTA, Relational • Software: Object Models; Web Services • Towards Protein Name Standards and Ontology • UniProt Guidelines for Protein Naming • Protein Name Dictionary and Thesaurus • PIRSF Classification-Based Protein Ontology Class Diagram PIR J2EE Bioinformatics Framework Web Services for PIR/UniProt Databases Baris E. Suzek, Hongzhan Huang, Sehee Chung, Hsing-Kuo Hua, Peter McGarvey, Zhangzhi Hu, Cathy H. Wu, Protein Information Resource, Georgetown University Medical Center, Washington, DC, USA 20057-1455 • Abstract • Protein Information Resource (PIR) is an integrated bioinformatics resource that provides protein databases and analysis tools to support genomic and proteomic research. PIR recently joined with the European Bioinformatics Institute (EBI) and Swiss Institute of Bioinformatics (SIB) to establish UniProt––the Universal Protein Resource––to produce a single worldwide resource of protein sequence and function, by unifying the PIR, Swiss-Prot, and TrEMBL database activities (http://www.uniprot.org). The UniProt Knowledgebase (UniProtKB) provides the central database of protein sequences with accurate, consistent, rich sequence and functional annotation. UniProtKB consists of two sections: Swiss-Prot, containing • manually-annotated records with information extracted from literature and curator-evaluated computational analysis, and TrEMBL, containing computationally analyzed records that await full manual annotation. One of the biggest challenges in life sciences research is the discovery, integration and exchange of data coming from multiple research groups. To make the PIR resource widely accessible to the research community and application programs, we are adopting an open-source, common-standard distribution practice and employing industry-standard J2EE technology to develop protein object models and web services. To make the PIR resource interoperable with other bioinformatics databases, we are developing controlled vocabularies and common data elements. • The web services is in the framework of the cancer Biomedical Informatics Grid (caBIGTM), an infrastructure connecting individuals and institutions to enable the sharing of data and tools for cancer research and developed under the leadership of National Cancer Institute’s Center for Bioinformatics (NCICB). PIR, as a participant of caBIGTM, is developing “Grid-enablement of PIR/UniProt Data Source” project. The goal of this project is to demonstrate how the PIR/UniProt data source can be discovered and consumed in a grid environment by creating an object layer and a web service layer for accessing the data source. The project has an n-tier architecture. The data layer, supported by Oracle 9i, stores the UniProtKB data. The data access layer utilizing Hibernate provides the mapping between relational database and object model. The object layer is developed using a Model Driven Architecture (MDA) approach. The use cases are developed with input from user community. The objects and their relations are designed using Unified Modeling Language (UML) in combination with existing UniProtKB XML schemas. An object-XML mapping tool (Castor) has been used to serialize/deserialize XML data from/to objects. The web service layer, supported by Apache Axis, provides language-independent programmatic access to the objects using SOAP protocol. The web services will facilitate many query mechanisms to access PIR/UniProt data: • • Identifier searches such UniProtKB ID, RefSeq number • • String-based searches for fields such as protein, gene name or keywords • • Boolean searches • The results are returned in XML and FASTA format for ease data exchange. To address the issues of data interoperability, PIR is participating in development of common data elements (CDE) as a part of caBIGTM Vocabulary and Common Data Elements (VCDE) activities. As members of the NIAID Administrative Resource for Proteomic Research Centers, the PIR team and the Virginia Bioinformatics Institute are developing a cyber infrastructure with a central proteomic database for the NIAID Proteomic Research Program. We have established an Interoperability Working Group (IWG) to discuss and address database interoperability issues. Interconnecting with the IWG and caBIG VCDE activities, we also participate in the HUPO PSI, focusing on mass spectrometry (PSI-MS) and general proteomics standards for formats (PSI-ML, XML format for data exchange), minimum reporting requirements (MIAPE), and ontologies (PSI-Ont). Model Driven Architecture Response Formats National Cancer Institute caBIGTM Initiative • Object Management Group’s Model Driven Architecture (MDA) provides an open, vendor-independent approach • MDA separates business and application logics from underlying technologies • PIR’s approach: • Analyze and develop the use cases • Developed in collaboration with the adopter from University of Pennsylvania, BioMedical Informatics Facility (BMIF) • Design the system using class diagram in UML • Generate the code UniProtKB Report http://www.pir.uniprot.org/entry/P00439 UniProtKB XML From caBIGTM site (http://cabig.nci.nih.gov/): “Voluntary network or grid connecting individuals and institutions to enable the sharing of data and tools, creating a World Wide Web of cancer research. The goal is to speed the delivery of innovative approaches for the prevention and treatment of cancer” • Use Cases • Setting search criteria • Simple Search is based on individual field; UniProtKB, PIR, ID or accession number, NCBI Taxonomy ID, PIR ID or accession number, NCBI GI, GenPept accession number, Locus ID/Entrez Gene ID, Refseq accession number, PDB ID with/without chain ID, OMIM ID, TIGR ID, EMBL ID, UniRef100/90/50 ID, UniParc ID, PubMed ID(PMID), PIRSF ID, PFAM ID, EC number, PROSITE ID, PRINTS ID, GO ID, InterPro ID, TIGRFAMS ID, Protein name, Gene name or symbol, Keywords, Scientific or common organism name, Sequence length, Molecular weight • Advanced Search is based on two fields combined with boolean operators “AND” , “OR” and “AND_NOT” • All-ID Search is a google-like search for the identifier fields if source of identifier is not known • Batch Retrieval using multiple UniProtKB IDs or accessions Architectural Design • Data layer is supported by Oracle 9i • UniProtKB is loaded to the database using: • Castor for UniProtKB XML to object mapping (http://castor.exolab.org) • Hibernate for object to database mapping (http://www.hibernate.org) • Domain Workspaces • Clinical Trial Management Systems • Integrative Cancer Research Workspace • PIR Developer Project: Grid Enablement of PIR/UniProt Data • PIR Adopter Project: SEED Genome Annotation Tool • Tissue Banks and Pathology Tools Workspace • Cross Cutting Workspaces • Architecture • Vocabularies and Common Data Elements • Setting Response Criteria • Default response: UniProtKB XML with UniProtKB ID/AC, protein/gene name(s), keywords, taxonomy, primary citation, cross-references and sequence information • Extended response: Default response plus gene location, feature, comments and all citations • FASTA response: Sequence file with identifier line containing UniProtKB ID, UniProtKB Primary_Accession, GO ID(s) and species name and protein name • Domain objects are designed using Enterprise Architect (EA) (http://www.sparxsystems.com/ea.htm) • Code for domain objects is generated using EA • Data access objects (DAO) are used to abstract and encapsulate the access to the database UniProtKB FASTA for caBIG >UniProKB ID Accession|GO ID(s)|Organism Name|Protein Name >1433B_HUMAN P31946|GO:0005515|Homo Sapiens|14-3-3 protein beta/alpha MAQPAELSREENVYMAKLAEQAERYEEMVEFMEKVAKTVDSEELTVEERNLLSVAYKNVI GARRASWRIISSIEQKEESRGNEDRVTLIKDYRGKIEVELTKICDGILKLLDSHLVPSST APESKVFYLKMKGDYYRYLAEFKSGTERKDAAENTMVAYKAAQEIALAELPPTHPIRLGL ALNFSVFYYEILNSPDRACDLAKQAFDEAISELDSLSEESYKDSTLIMQLLRDNLTLWTS DISEDAAEEMKDAPKGESGDGQ • Apache Axis is used as SOAP Engine (http://ws.apache.org/axis/) • Object serialization to UniProtKB XML is done at runtime using Castor mapping files instead of complied mapping descriptors NIAID Biodefense Proteomic Centers Acknowledgements PIR and caBIGTM Common Data Elements (CDE) • Seven National Proteomic Research Centers • Administrative Resource Centers: SSS, GU-PIR, VT-VBI • Administrative Resource Activities • Administrative Support • Scientific Coordination: • Scientific Working Group • Interoperability Working Group • Cyber Infrastructure • Central Web Site: Single Point of Access • Proteomic Database: Data Storage and Retrieval • Integrated Protein Knowledge System: Functional Interpretation • Interoperability Working Group (IWG) • Discuss and address database interoperability issues • Participate in the HUPO PSI, focusing on mass spectrometry (PSI-MS) and general proteomics standards for formats (PSI-ML, XML format for data exchange), minimum reporting requirements (MIAPE), and ontologies (PSI-Ont). • CDEs required for semantic interoperability in caBIG • CDEs stored in caDSR which maintains metadata to permit a user to locate the correct defining characteristics of a piece of datum, an instance of a specific concept • UMLs for object model registered to • PIR’s CDE related activities: • Participate in creation of Gene CDE: • Genomic Identifiers • Taxonomy • Creation of CDEs for UniProtKB based on the object model • Research Projects • NIH: NHGRI/NIGMS/NLM/NIMH/NCRR/NIDCR (UniProt) • NIH: NIAID (Proteomic Administrative Resource) • NIH: NCI caBIG (Grid, SEED) • NSF: BDI (iProClass) • NSF: SEIII (Entity Tagging) • NSF: ITR (Ontology) • US Air Force: EOS (Epidemic Outbreak Surveillance) • Computing Resources • Sun Microsystems AEG grant (V880) • IBM SUR grant (P690)

More Related