Download
patologi umum penyakit infeksi n.
Skip this Video
Loading SlideShow in 5 Seconds..
Patologi Umum Penyakit Infeksi PowerPoint Presentation
Download Presentation
Patologi Umum Penyakit Infeksi

Patologi Umum Penyakit Infeksi

1567 Vues Download Presentation
Télécharger la présentation

Patologi Umum Penyakit Infeksi

- - - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript

  1. PatologiUmumPenyakitInfeksi Dr. EttyHaryKusumastuti, Sp. PA

  2. Infeksiadalahmasuknyamikroorganismepatogendalamtubuhmanusia (host) • Timbulperubahan/kerusakansel & jaringanmenimbulkankeluhanpenderitadisertaigejalaklinik.

  3. MasaInkubasi : masatenggangwaktumulaisaatpertama kali mikroorganismepatogenmasukdalamtubuhmanusiasampaipertama kali timbulnyagejalaklinik. • Bervariasicukupbesartergantungjenismikroorganismenya, & bervariasisedikittergantungfaktormanusianya. • InfeksiPenyakitinfeksi

  4. Walaupunduniakesehatanterusberkembang, namunpenyakitinfeksimasihbanyakmenimbulkankorban

  5. Di negaraberkembangkondisilingkungan yang tidakbersihsertaangkamalnutrisi yang tinggiberperandalampenyakitinfeksidanmengakibatkankematianlebihdari 10 jutaorangsetiaptahun. Sebagianbesarakibatinfeksisaluranpernapasandandiare.

  6. Bahkandi USA penyebabkematiantertinggike 2 disebabkanpenyakitinfeksi (pneumonia dan sepsis). Infeksi yang pentingmenyebabkankematianakibat AIDS.

  7. SEJARAH • Edward Jenner, 1796 mengamatipemerahsusu kebalterhadapcacar. Virus vaccinia (cacarsapi) memicureaksiimun yang menetralkaninfeksiberikutnyaoleh virus variolacacar yang lebihvirulen.

  8. Louis Pasteur, 1865, orangpertamamembuktikanbahwamikroorganismadapatmenyebabkanpenyakit (germ theory of disease), menghasilkanvaksin attenuated pertama.

  9. 1882, Robert Koch menghubungkanantara basil Anthrax dg penyakittertentuPostulat Koch • organismaselaluditemukanpadalesipenyakit, • organismadapatdiisolasidalam media kultur, • inokolasibiakanmenyebabkanpenyakitpadahewancoba, • organismadapatditemukanpadalesipenyakitbinatangcobatersebut.

  10. KategoriAgenInfeksi

  11. VIRUS • Microorgterkecil (20-300 nm), sangatsederhana • Gumpalan nucleic acid • DNA/RNA virus tergantungkandungan nucleic acid • Bentuktergantung coating protein • Saatinidikenal 400 species • Obligate intracellular (untukreplikasi) • Dilihatdengan electron microscope • Inclusion bodies

  12. Inclusion Bodies pada Herpes (virus)

  13. Penggolongan Virus berdasarkan penyakit yang diakibatkannya: • Virus yang menyerang trac. Respirasi • Virus yang menyerang trac. Digestive • Sistemik dengan kelainan pada kulit • Sistemik dengan gangguan hematopoitic • Arbovirus & hemorrhagic Fever • Pertumbuhan Condiloma • CNS

  14. PRION • Bentuk abnormal dari protein host, resistensterhadap protease. • Ageninimengakibatkanantara lain spongioform encephalitis

  15. BAKTERI • Prokaryocyte, tidakmemilikiinti & endoplasmic reticulum • Gram + : Peptidoglycandengan single phospholipid layer Gram - : Double phospholipid layer • Mensintesasendiri DNA, RNA & protein • Dapathidup intra maupun extra sel • Bentuk : coccen, batang, koma, spiral • Memilikiexo & endotoksinsertaenzimtertentu • Aerobatauanaerob

  16. Diagram bakteri gram - & gram +

  17. Penggolongan penyakit infeksi bakteri, spirochaeta & mycobacterium : • Infeksi oleh piogenik coccen • Infeksi gram – • Infeksi pada anak-anak • Infeksi saluran cerna • Infeksi Clostridium • Infeksi bacterial Zoonotic • Infeksi golongan Treponemal • Infeksi golongan Mycobacterium • Infeksi golongan Actinomycetaceae

  18. Bentuk bacteri : coccen, batang, koma, spiral

  19. FUNGI ( JAMUR ) • In-vitro : bentuksempurna, reproduksisecaraseksual • In-vivo : imperfect, hyphae Kadangberspora • Dikenal Superficial & Deep mycosis • PertumbuhanmeningkatpadaterapiImunosupresan / AIDS dll

  20. Berbagai jenis jamur yg sering dijumpai Candida Candida Cryptococcus Aspergillus

  21. PROTOZOA • Microorganisme bersel satu, pseudopodi • Digolongkan : 1. Hidup dalam epitel atau lumen organ 2. Dalam darah 3. Dalam sel jaringan. Detailnya sebagai berikut :

  22. HELMINTH ( CACING ) • Microorganisme multi seluler • Sikluskehidupannyakompleks • Bentukan : telur – larva – bentukdewasa (lihatkuliahParasitologi)

  23. Strongyloides • Larva menembuskulit peredarandarah  jantung  paru  di trachea dan larynx  dibatukan  tertelan, parasitsampaidiusus, menjadidewasa

  24. Cysticercus cyst • Manusia host T. solium telurcacing pita babi  dagingtidakterolah dg baik • Telur T. soliumtermakan host

  25. Filariasis FibrosisLiver pada Schistosomiasis

  26. Ascaris lumbricoides

  27. Trichuris trichiura

  28. Endo Parasit EctoParasit • Golonganserangga (kutu, dll), nyamuk, kumbang, dll  gatal, ekskoriasi. • Vektor

  29. TransmisidanDiseminasiMikroba

  30. SISTIM PERTAHANAN TUBUH MANUSIA • Kulit & mukosa yg intak dg secret excretorisnya (pasif) • Sel-sel radang / RES termasuk plasma protein dan mediator-mediator • Reaksi Imunologis (T & B Limfosit)

  31. Microorganisme masuk melalui saluran-saluran yang ada pada tubuh manusia : • Inhalasi • Ingestion • Hubungan seksual • Gigitan serangga / • hewan / injeksi

  32. KULIT • Permukaan luar dihuni bakteri & jamur patogen/ komensal • Infeksi terjadi : • Kulit terkena trauma, luka • Gigitan nyamuk, suntikan dll • Mikroorganisme aktif masuk (enzym bakteri, larva cacing) • Jamur menyerang lapisan keratin Sifat kulit : tebal, berlapis, pH rendah (5,5)

  33. Epitel bertatah/epidermis (kiri) & epitel silindris/mukosa (kanan)

  34. SALURAN NAFAS • Bag atas : Hidungsampai trachea • Bag bawah : Trachea-bronchus-alveoli • Mucocilliaris bronchus & reflex batukmencegahinfeksi • Mucocilliaristerganggu/rusak : - asaprokok, bahan irritant - asamlambungpadaregurgitasi - trauma padaintubasi - akibatinfeksi virus , dll

  35. SALURAN CERNA • Mulaimulut, esofagus, gaster, usussampai rectum • Perlindunganterhadapinfeksi : - Enzympencernaanpadamulut - Asamlambung - Enzymlitik pancreas & empedu - Epitelmukosausus, membentukmukus layer - Ig A antibodi - Kumankomensal & rutindefekasi

  36. URO GENITAL • Urine yang asam • Sfingter urethra • Padawanita : Vagina asam, sertasumbatlendirpekat cervix

  37. Bila pertahanan pasif ini gagal, masih ada pertahanan aktif : • Sel radang / RES • Reaksi Imunologis (dibahas pd kuliah imunologi)

  38. PENYEBARAN MICROORGANISMA • Melaluikulit & mukosa (hangat & lembablebihcepatdaripadakeringataudingin) • Berdiamdalampermukaan organ berupatabung (cholera, exotoksin) • Berikatan & proliferasiselepitel (virus) • MenyebardariprodukLyticenzymataumotilitasparasit (bakteri, jamur, cacing) • Penyebaranmelaluijaringankendoratauserosa cavity • Melaluialiranlimfe & alirandarahkeseluruhjaringantubuh • Menumpangmakrofag • Melaluisaraf

  39. Gambar : Penyebaran microorganisme • Port d’entree • Route of infection • Target organ

  40. Lesi berupa : • Single di tempat asal • Multiple di banyak organ • Kecil-kecil tersebar (miliary) • 1, sangat besar (tuberculoma)

  41. Lokasi : • Lesiberadapadatempatasal • Lesiberadapadatempat lain : Chiken pox & measle; Infeksimelaluisalurannafas, lesidikulit. Polio : Infeksimelalui GI, lesipada motor neuron • Invasimelaluialirandarah : microorganismemaupuntoksinnya : timbul sepsis luas, kematian • Aliran placental : kelainanjanin, premature ataulahirmati

  42. Cara Penularan • Kontak langsung • Melalui udara (air borne) • Ingesi (food borne) • Route fecal-oral • Melalui injeksi & gigitan vector • Sexual transmitted • Multiple route • Melalui Placenta

  43. Cara MicroorganismaMenimbulkanPenyakit

  44. Cara microorganisme menimbulkan penyakit secara garis besar : • Kontak host cell, kematian sel • Melalui exo & endotoksin, atau melalui enzym tertentu, timbul nekrosis • Menginduksi host cellular respons, timbul kerusakan jaringan di tempat jauh