amaris
Uploaded by
1 SLIDES
162 VUES
10LIKES

Comprehensive Analysis of LRH-1 Variants Across Multiple Species

DESCRIPTION

This study presents an in-depth examination of LRH-1 protein variants across diverse species, including humans, mice, chickens, Xenopus, and zebrafish. We compare variants V1 through V5 from various organisms, analyzing their amino acid sequences and potential functional implications. The investigation provides insights into evolutionary conservation and divergence in LRH-1 function, highlighting critical sequence alignments that may inform future biological research. Supplementary data, including figures and sequence details, support our findings.

1 / 1

Télécharger la présentation

Comprehensive Analysis of LRH-1 Variants Across Multiple Species

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript

Playing audio...

  1. A B 11.7 kb Human LRH-1-V1 Human LRH-1-V4 Human LRH-1-V5 Mouse LRH-1-V1 Mouse LRH-1-V2 Chicken LRH-1 Xenopus LRH-1 Zebrafish LRH-1 C HUMAN V1 1 MSSNSDTGDLQESLKHGLTPI---------------------GAGLPDRHGSPIPARGRLVMLPKV 45 Human V2 1 MSSNSDTGDLQESLKHGLTPI--------------------------------------------- 21 Human v4 1 -------------------------------------------------------------MLPKV 5 Human v5 ------------------------------------------------------------------ Mouse V1 1 MSASLDTGDFQEFLKHGLTAIASAPGSETRHSPKREEQLREKRAGLPDRHRRPIPARSRLVMLPKV 66 Mouse V2 1 -------------------------------------------------------------MLPKV 5 CHICKEN 1 -------------------------------------------------------------mlpkv 5 xenopus 1 -------------------------------------------------------------mlpkv 5 ZEBRAFISH 1 -------------------------------------------------------------MLPKV 5 Human v1 46 ETEALGLARSHGEQGQMPENMQVSQFKMVNYSYDEDLEELCPVCG 90 Human v2 22 ----------------------VSQFKMVNYSYDEDLEELCPVCG 69 Human v4 6 ETEALGLARSHGEQGQMPENMQVSQFKMVNYSYDEDLEELCPVCG 50 Human v5 1 -----------MATQAGQLQAKVSQFKMVNYSYDEDLEELCPVCG 34 Mouse v1 67 ETEAPGLVRSHGEQGQMPENMQVSQFKMVNYSYDEDLEELCPVCG 111 MOUSE V2 6 ETEAPGLVRSHGEQGQMPENMQVSQFKMVNYSYDEDLEELCPVCG 50 CHICKEN 6 etealglarsngeqgqmpenmqvsqfkmvnysydedleelcpvcg 50 XENOPUS 6 epealglsrshgeqghmpenmqasqfkmmgysydeeleemcpvcg 50 ZEBRAFISH 6 ESEYLGLARSHGEQGHMPGNMQAPQFKMMDYSYDEDLDEMCPVCG 50 Thiruchelvam et al Supplementary Figure 1

More Related