B-Cell Epitopes
B-Cell Epitopes. Chapter 10. Claus Lundegaard. Antibodies. Antibodies. What are they?. Virtually any substance can elicit an antibody response. Clear extra cellular pathogens neutralizing antibodies Antibody repertoire > 10 11 in humans How is this possible?
B-Cell Epitopes
E N D
Presentation Transcript
B-Cell Epitopes • Chapter 10 Claus Lundegaard
Antibodies. What are they? • Virtually any substance can elicit an antibody response. • Clear extra cellular pathogens • neutralizing antibodies • Antibody repertoire • > 1011 in humans • How is this possible? • ~ 30.000 genes in the humans genome! • Immunoglobulin gene rearrangement
Antibody Effect. Neutralizing Antibodies Virus or Toxin Neutralizing Antibodies Inhibit cellular infection Clear pathogen infection
Paratope Antibody - Antigen interaction Antigen Fab (fragment antigen binding) Epitope Antibody
B-Cells. How are they made? Stem Cell Precurser B-lymphocytes Gene rearrangements B-lymphocytes each displaying a unique B-cell receptor
The 12/23 rule of recombination recombination signal sequence (RSS) { Only combined 12 RSS to 23 RSS
Addition of P and N nucleotides TdT: terminal deoxynucleotidyl transferase
Antibody variable regions, CDR’s (Complementarity-determining regions)
CDR Regions Variable regions Alpha-carbon trace of the structure of the heavy chain and light chain variable regions of a typical antibody. The framework regions of both chains are shown in grey whilst the complementarity determining regions (CDRs) are coloured individually, i.e. Heavy chain CDR 1 = Light blue CDR 2 = Cerise CDR 3 = Yellow Light Chain CDR 1 = Red CDR 2 = Green CDR 3 = Blue CDR = complementarity determining region http://212.219.234.139/html/anti_alpha.html
Identifying CDR regions • The Kabat definition is based on sequence variability and is the most commonly used • The Chothia definition is based on the location of the structural loop regions • The AbM definition is a compromise between the two used by Oxford Molecular's AbM antibody modelling software • The contact definition has been recently introduced by us and is based on an analysis of the available complex crystal structures.
Identification of CDR’s (II) CDR-H1 Start Approx residue 26 (always 4 after a Cys) [Chothia / AbM defintion]; Kabat definition starts 5 residues later Residues before always Cys-XXX-XXX-XXX Residues after always a Trp. Typically Trp-Val, but also, Trp-Ile, Trp-Ala Length 10 to 12 residues [AbM definition]; Chothia definition excludes the last 4 residues CDR-H2 Start always 15 residues after the end of Kabat / AbM definition) of CDR-H1 Residues before typically Leu-Glu-Trp-Ile-Gly, but a number of variations Residues after Lys/Arg-Leu/Ile/Val/Phe/Thr/Ala-Thr/Ser/Ile/Ala Length Kabat definition 16 to 19 residues; AbM (and recent Chothia) definition ends 7 residues earlier CDR-H3 Start always 33 residues after end of CDR-H2 (always 2 after a Cys) Residues before always Cys-XXX-XXX (typically Cys-Ala-Arg) Residues after always Trp-Gly-XXX-Gly Length 3 to 25(!) residues
Example • >BU02A02.1 • GVQCEVHLLESGGGLVQPGGSLRLSCAASGFTFYSYAMSWVRQAPGKGLEWVSANSGSGGSTYYADSVRGRFTISRDNSKNTLYLQMNSLSAEDTAVYFCAKAPGYYYYYGMDVWGQGTTVTVSSGKNGHSRAFV 15 amino acids after end of CDR1
B-Cell Activation (Proliferation depends on affinity) No Affinity No Affinity Low Affinity Somatic Hypermutations High Affinity Plasma cells Memory B-cells
B-Cell Activation T Helper Cell TCR B Cell Class II MHC Bound Peptide
Controversial issues • Is the 11/23 rule always obeyed? • Can you have multiple D genes? • Can D genes be inserted backwards? • I.e can both D and the inverted D genes be used? • Does V, D and J palindrom segments exits?
What did we find? • Issue of next talk