1 / 11

Plant Phylogenetic Tree: Gene Expression Profiles and Mutants

Explore gene expression profiles of At5g37990, At5g37970, At5g38780, and more in roots, leaves, and stress conditions. Discover knockout mutants, over-expression, and promoter-GUS analysis. Investigate the phylogenetic relationships.

corina
Télécharger la présentation

Plant Phylogenetic Tree: Gene Expression Profiles and Mutants

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. Phylgenetic tree

  2. >70 % identity ~60% identity >85% identity

  3. MT-1 ( At5g37990) • 1. Expression profile- roots (R), leaves (L), Se –treated with NaCl, 4oC, H2O stress • 2. Available knock-out mutants–Y/homozygous/intron • 3. Over-expression – Y • 4. Promoter-GUS -Y • *putative signal peptide • mlsaflghasaiaiaspvvsivgirrqtygemkhvgvvekqr

  4. MT-2 ( At5g37970) • 1. Expression profile – roots (R), leaves (L), Se –treated with 4oC, H2O stress • 2. Knock-out mutants-NO • 3. Over-expression - YES • 4. Promoter-GUS - YES • *putative signal peptide • Mlsafwghasaiaiaspvvsivgfqgdrttirrptygemkfvdvverpr – no predicted cleveage signal

  5. MT-3 ( At5g38780) • 1. Expression profile- R, Leaves, Se, SeNaCl, Se4oC, Water treated leaves • 2. Available knock-out mutants-Y-homozygous/exon • 3. Over-expression - Y • 4. Promoter-GUS – Y • *Microarray: detected in senescent leaves /SA, JA mutants/

  6. MT-4 ( At5g38100) • 1. Expression profile-St, L, F, R, Se, Se-NaCl, Se-4oC • 2. Available knock-out mutants-?-one putative, 5`UTR • 3. Over-expression - Y • 4. Promoter-GUS - Y

  7. MT-9 ( At5g68040) • 1. Expression profile - R • 2. Available knock-out mutants-Y/homozygous/exon • 3. Over-expression - Y • 4. Promoter-GUS - Y

  8. MT-12 ( At5g56300) • 1. Expression profile-developing seeds, F, R, L, Se, Se-NaCl, Se-4oC • 2. Available knock-out mutants -Y/heterozygous • 3. Over-expression - Y • 4. Promoter-GUS - Y

  9. MT-13 ( At5g26420) • 1. Expression profile-exclusively in developing seeds • 2. Available knock-out mutants-? two putative mutants • 3. Over-expression - Y • 4. Promoter-GUS -Y

  10. Developing siliques Flower MT-12 MT-13 MT-4 MT-12 Back to the first MT-1, MT-2 MT-3 MT-4 MT-12 LEAVES Se MT-4 MT-12 MT-9? MT-3? Roots MT-1,2,3,4,9,12

More Related