Thornton Group databases
Thornton Group databases. Roman Laskowski, EBI. Protein-Protein interaction server. Protein-DNA interaction server. DNA-binding protein structural families. Scorecons. http://www.ebi.ac.uk/Thornton/databases.html.
Thornton Group databases
E N D
Presentation Transcript
Thornton Group databases Roman Laskowski, EBI Protein-Protein interaction server Protein-DNA interaction server DNA-binding protein structural families Scorecons http://www.ebi.ac.uk/Thornton/databases.html
PDBsum: A database of the known 3D structures of proteins and nucleic acids
Other databases Protein-Protein interaction server Protein-DNA interaction server DNA-binding protein structural families Scorecons Sidechain-sidechain interactions
SG structures of unknown function in the PDB Known function 350 (50.2%) Unknown function 347 (49.8%) Known function 350 (50.2%) Hypothetical 239 (34.3%) Others 108 (15.5%) Examples 697 SG structures in PDB as of Jul 2004 • Hypothetical protein Af0491 from A. fulgidus • Ubiquitin-like domain from mouse • Signalling protein from sheep • Putative serine hydrolase from S.cerevisiae • Predicted glutamine amidotransferase from P. aeruginosa • Probable eukaryotic D-amino acid tRNA deacetylase • Molybdenum cofactor biosynthetic enzyme
Predicting function from 3D structure A L Y F G H I L V Y S T F P N E E K A L E I G R K L L E K R L I A C F N A F E I R S G Y W W K G E I V Q D K E W A A I F K T T E E K E K E L Y E E L R K L H P Y E T P A I F T L K V E N I L T E Y N W L R E S V L G S
Predicting function from 3D structure ALYFGHILVYSTFPNEEKALEIGRKLLEKRLIACFNAFEI RSGYWWKGEIVQDKEWAAIFKTTEEKEKELYEELRKLH PYETPAIFTLKVENILTEYNWLRESVLGS
ProFunc Fold and structural motifs n-residue templates Sequence scans Sequence search vs PDB Enzyme active sites SSM fold search Sequence search vs Uniprot Ligand binding sites Surface clefts Sequence motifs (PROSITE, BLOCKS, SMART, Pfam, etc) Residue conservation DNA binding sites DNA-binding HTH motifs Superfamily HMM library Reverse templates Nest analysis Gene neighbours
GARTfase Cholesterol oxidase IIAglc histidine kinase Template methods eg 189 enzyme active site templates … Carbamoylsarcosine amidohhydrase Ser-His-Asp catalytic triad Dihydrofolate reductase
Automatically generated templates 1. Small-molecule-binding templates 2. DNA-binding templates
“Reverse” templates (SiteSeer) 3-residue templates 1 2 3 4 5 6 7 8 9 … Query structure Query structure
Scoring template matches Ser Match to template: Arg Glu Template structure – 1mbb Query structure – 1hsk
Scoring template matches Ser Match to template: Arg Glu Template structure – 1mbb Query structure – 1hsk
Scoring template matches Ser Arg Glu Similar residues in neighbourhood: Template structure – 1mbb Query structure – 1hsk
Chitinase A Chitinase B 1ctn (538 a.a.) 1gpf (497 a.a.) An example:chitinase A and Bfrom S.marcescens Sequence identity of 28.7% (in 428 a.a. o/lap) So, function likely to be different
Template for E.C.3.2.1.14 comes from chitinase A structure 1ctn: Asp391 Glu315 Chitinase A Chitinase A is an enzyme (E.C.3.2.1.14) breaks chitin into its constituent GlcNac residues
25 identical residues + 8 similar residues = = 50% local seq identity cf 28.7% overall Chitinase B matches E.C.3.2.1.14 template Chitinase B with a high site similarity score
Chitinase B is also an E.C.3.2.1.14 enzyme and breaks chitin into its constituent GlcNac residues Superposition of chitinase A and B