doris-burns
Uploaded by
44 SLIDES
597 VUES
440LIKES

Thornton Group databases

DESCRIPTION

Thornton Group databases. Roman Laskowski, EBI. Protein-Protein interaction server. Protein-DNA interaction server. DNA-binding protein structural families. Scorecons. http://www.ebi.ac.uk/Thornton/databases.html.

1 / 44

Télécharger la présentation

Thornton Group databases

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. Thornton Group databases Roman Laskowski, EBI Protein-Protein interaction server Protein-DNA interaction server DNA-binding protein structural families Scorecons http://www.ebi.ac.uk/Thornton/databases.html

  2. PDBsum: A database of the known 3D structures of proteins and nucleic acids

  3. Example PDBsum page

  4. Protein page

  5. Residue conservation

  6. Protein page again

  7. SAS hits for 1bpy

  8. SAS annotations

  9. SAS home page

  10. DNA page

  11. Ligand page

  12. Enzyme reaction

  13. Enzyme Structures Database

  14. EC 1.1.1.1

  15. PDBsum home again

  16. Species page

  17. PDBsum home again

  18. Highlights page

  19. Smallest structures page

  20. 1tn1 page

  21. Catalytic site atlas home page

  22. CSA entry

  23. CSA entry II

  24. CSA partial search

  25. MSA home page

  26. MSA entry

  27. Pita home page

  28. Pita results for 1sip

  29. Other databases Protein-Protein interaction server Protein-DNA interaction server DNA-binding protein structural families Scorecons Sidechain-sidechain interactions

  30. ProFunc home page

  31. SG structures of unknown function in the PDB Known function 350 (50.2%) Unknown function 347 (49.8%) Known function 350 (50.2%) Hypothetical 239 (34.3%) Others 108 (15.5%) Examples 697 SG structures in PDB as of Jul 2004 • Hypothetical protein Af0491 from A. fulgidus • Ubiquitin-like domain from mouse • Signalling protein from sheep • Putative serine hydrolase from S.cerevisiae • Predicted glutamine amidotransferase from P. aeruginosa • Probable eukaryotic D-amino acid tRNA deacetylase • Molybdenum cofactor biosynthetic enzyme

  32. Predicting function from 3D structure A L Y F G H I L V Y S T F P N E E K A L E I G R K L L E K R L I A C F N A F E I R S G Y W W K G E I V Q D K E W A A I F K T T E E K E K E L Y E E L R K L H P Y E T P A I F T L K V E N I L T E Y N W L R E S V L G S

  33. Predicting function from 3D structure ALYFGHILVYSTFPNEEKALEIGRKLLEKRLIACFNAFEI RSGYWWKGEIVQDKEWAAIFKTTEEKEKELYEELRKLH PYETPAIFTLKVENILTEYNWLRESVLGS

  34. ProFunc Fold and structural motifs n-residue templates Sequence scans Sequence search vs PDB Enzyme active sites SSM fold search Sequence search vs Uniprot Ligand binding sites Surface clefts Sequence motifs (PROSITE, BLOCKS, SMART, Pfam, etc) Residue conservation DNA binding sites DNA-binding HTH motifs Superfamily HMM library Reverse templates Nest analysis Gene neighbours

  35. GARTfase Cholesterol oxidase IIAglc histidine kinase Template methods eg 189 enzyme active site templates … Carbamoylsarcosine amidohhydrase Ser-His-Asp catalytic triad Dihydrofolate reductase

  36. Automatically generated templates 1. Small-molecule-binding templates 2. DNA-binding templates

  37. “Reverse” templates (SiteSeer) 3-residue templates 1 2 3 4 5 6 7 8 9 … Query structure Query structure

  38. Scoring template matches Ser Match to template: Arg Glu Template structure – 1mbb Query structure – 1hsk

  39. Scoring template matches Ser Match to template: Arg Glu Template structure – 1mbb Query structure – 1hsk

  40. Scoring template matches Ser Arg Glu Similar residues in neighbourhood: Template structure – 1mbb Query structure – 1hsk

  41. Chitinase A Chitinase B 1ctn (538 a.a.) 1gpf (497 a.a.) An example:chitinase A and Bfrom S.marcescens Sequence identity of 28.7% (in 428 a.a. o/lap) So, function likely to be different

  42. Template for E.C.3.2.1.14 comes from chitinase A structure 1ctn: Asp391 Glu315 Chitinase A Chitinase A is an enzyme (E.C.3.2.1.14) breaks chitin into its constituent GlcNac residues

  43. 25 identical residues + 8 similar residues = = 50% local seq identity cf 28.7% overall Chitinase B matches E.C.3.2.1.14 template Chitinase B with a high site similarity score

  44. Chitinase B is also an E.C.3.2.1.14 enzyme and breaks chitin into its constituent GlcNac residues Superposition of chitinase A and B

More Related
SlideServe
Audio
Live Player
Audio Wave
Play slide audio to activate visualizer