Download
air kelapa dan santan kelapa n.
Skip this Video
Loading SlideShow in 5 Seconds..
Air Kelapa dan Santan Kelapa PowerPoint Presentation
Download Presentation
Air Kelapa dan Santan Kelapa

Air Kelapa dan Santan Kelapa

501 Vues Download Presentation
Télécharger la présentation

Air Kelapa dan Santan Kelapa

- - - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript

  1. Air KelapadanSantanKelapa Add your company slogan wideliaikaputri@ub.ac.id

  2. Air Kelapa • Air kelapamuda langsungdikonsumsisebagaiminuman. • Air kelapatua : • Nata de coco • Vinegar (Cuka) • Kecap • Diolahmenjadiminuman • Dll. (Air kelapasegar steril) www.themegallery.com

  3. Manfaatnyasebagaiminuman • Megandungzatgizi sumberkalori • Melancarkanurin (Diuretic) • Baikbagipenderitatensitinggi • Penghilangdahaga www.themegallery.com

  4. Nilaigizi air kelapa (%DB) www.themegallery.com

  5. Penelitiankhasiat air kelapa • Air kelapadiekstrakdenganetanol. • Ekstrakdiujiaktivitasantioksidan-nyasecarain vitro. • Ternyataekstraktsbmempunyaiaktivitasantioksidan. • Ekstrakdiujisecara in vivo,yaitudiberikankepadatikuspercobaan. www.themegallery.com

  6. Ada 2 kelompoktikus (A dan B), keduanyadiberikanminyaktengik yang bisameracuni. Kelompok A diberikanekstrak air kelapa, kelompok B tidakdiberikan (hanyadiberikan air). • Setelahbeberapahari, ternyatakelompok B sangatparahkeracunanminyaktengiktsb yang ditandaidenganangka TBA yang tinggi, sedangkanKelompok A tidaktinggiangka TBA nya (Tdkkeracunan). • Ekstrak air kelapa khasiatantioksidatif. www.themegallery.com

  7. Kesimpulanpenelitian • Air kelapa bergizi • Fungsional  berkhasiat (sumberantioksidan) www.themegallery.com

  8. SantanKelapa (Coconut Milk) • Produksi • Pengaruhtingkatketuaan (maturity) • Pengaruhukuranpartikeldantekananekstraksi • Pengaruhsuhudanrasio air : dagingkelapa • Pengaruhpenyimpananbekudanpemanasandagingkelapaygdibekukan www.themegallery.com

  9. Struktursantan • Agensiapengemulsidalamsantan • Komposisidansifatfisikokimia www.themegallery.com

  10. Deskripsi • Santanadalahistilah yang digunakanuntukmenunjukcairan yang diperolehdenganekstraksi manual ataumekanikaldagingkelapaparutdenganatautanpapenambahan air. • Santan yang diekstraktanpapenambahan air sangatkental (di Philippine disebutkakanggata). • Bedanyadengan “coconut cream” ? www.themegallery.com

  11. “Coconut milk” adalahcairanmenyerupaisusudiekstraksegardaridagingkelapadenganatautanpapenambahan air, sedangkan “coconut cream” adalahbahanmenyerupaicreamdengankandunganlemaktinggidiperolehdarisantandengancarapemisahangravitasiatausentrifugasi. • Di duniaperdaganganadaistilah lain, “cream of coconut” yaituproduksantan yang dimaniskan, sedangkan “cream coconut” kelapakering yang digiling. • Santanmerupakanbagianpentingdarimasakansehari-haridinegara-negarapenghasilkelapa. www.themegallery.com

  12. Karena • Citarasagurih • Nilaigizi • Untukberbagaimacam ingredient / ditambahkandalammasakan. • Pemanfaatan: • Dikonsumsidomestik • Diperdagangkandalambentuksantankalengandanbentukkering. • (Estimasikonsumsi Indonesia 6,5-8,2 kg/kapita/th.) www.themegallery.com

  13. Pengolahan • Pengolahansantandilakukandenganekstraksidarikelapaparutdenganatautanpapenambahan air. • Disebutmetodebasah. • Perludiperhatikansupayadapatmemanfaatkansemaksimalmungkinkelapauntukpangan, yaitumenghasilkanproduk-produksantan, air, danampas yang layakdikonsumsi. www.themegallery.com

  14. Santanbiasanyadiproduksidaribuahkelapaumur 12 bulan. • Padaumurinidagingkelapatebaldankeras, dengankomposisikuranglebih 50% air, 34% minyak, 3.5% protein 3.0% serat, 2.2% abu, dan 7.3% karbohidrat. • Secaratradisionalsantandibuatdirumahtanggadenganpenambahan air padaparutankelapa, dipress/ diperasdandisaringdengankainsaring. • Alatparutnyasederhana • Prosesekstraksisantanscrtradisional www.themegallery.com

  15. Pemanfaatansantan • Sbg ingredient dalammasakan. • Dipanaskanuntukmenghasilkanminyak (minyakklentik/ krengsengan) • Dengancarakrengsenganinidapatmengekstrakminyak 70%. Protein-nyadapatdiperolehsebagaiblondo. • Kelemahancaraini: tidakefisiendanterdapatkehilanganbahan. • Ampas (di Philippine disebutsapal) dengankadar air 47% masihmengandungminyak 25-28% (atau 40%DB). www.themegallery.com

  16. Di sampingdipengaruhiteknologipengolahannya, hasilsantandipengaruhioleh: • Jenis (varietas) kelapa • Tingkat ketuaan • Ukuranpartikeldagingkelapa • Suhupengolahan • Rasioair:kelapaparut • Tekananekstraksi. www.themegallery.com

  17. Pengaruhtingkatketuaankelapa: • Tingkat ketuaankelapasangatberpengaruhterhadaphasilsantan. • Kelapatuadenganwarnasabutcoklatdanbelumtumbuh tunas memberikanhasil (yield) santanterbanyak. www.themegallery.com

  18. (SatuhudanSunarmani, 2004) www.themegallery.com

  19. Pengawetansantan • Pengalengan (Canning) • Opsiteknologi/ rekomendasiuntukproduksisantankalengan • Santankering (Dehydrated coc. milk) • Pengawetansantansebagaikonsentratgula www.themegallery.com

  20. THANK TO MR. UMAR SANTOSO www.themegallery.com

  21. Thank You ! www.themegallery.com