hertz
Uploaded by
15 SLIDES
389 VUES
200LIKES

Cold Shock Vectors

DESCRIPTION

Cold Shock Vectors. Optimal Growth Acclimation Steady Low Temp Growth Stationary 37ºC Phase Adapted Cells Phase. CSPs. Growth Curve. Non-CSPs. CSPs. Non-CSPs. Induction of cold-shock proteins in Esherichia coli. 37 °C. 15. , 30 min.

1 / 15

Télécharger la présentation

Cold Shock Vectors

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. Cold Shock Vectors

  2. Optimal GrowthAcclimation Steady Low Temp Growth Stationary 37ºCPhase Adapted Cells Phase CSPs Growth Curve Non-CSPs CSPs Non-CSPs

  3. Induction of cold-shock proteins in Esherichia coli 37°C 15 , 30 min 15 °C , 1 hr °C

  4. ▪ Protein Unfolding ▪ Protein Degradation Cold shock Heat shock ▪ RNA Stabilization RNA Chaperones Molecular Chaperones ▪ Ribosome Dysfunction RbfA, CsdA Proteases ▪ mRNA Degradation PNPase

  5. W11 The primary and tertiary structure of CspA -4  -5 -2 -1 MSGKMTGIVKWFNADKGFGFITPDDGSKDVFVHFSAIQNDGYKSLDEGQKVSFTIESGAKGPAAGNVTSL RNP2 RNP1 F12 Y42 F20 F53 F34 F18 H33 F31

  6. The molecule number of CspA homologues in cold-shocked cells Cold shock time (hr) Purified CspA protein (ng) 0 1 3 6 1 2 4 8 16 32 64 128 37ºC 15ºC C I C I E B A G E B A G CspA : 1 × 106 molecules/cell ( CspA + B + G + E : 2 × 106 molecules/cell )

  7. Effect of nonsense mutations AUG A cspA promotor 5’-UTR SD coding sequence 3’-UTR * pJJG02 * * pA01S * * pA10S * * pA30S pUC19 pJJG02 pA01S pA10S pA30S B C 5 0 1 3 6 hr 0 1 3 6 0 1 3 6 CS: 0 1 3 6 01 3 6 pUC19 4.5 pJJG02 4 pA01S pA10S 3.5 pA30S 3 OD600 2.5 2 1.5 1 0.5 0 0 2 4 6 8 10 12 14 16 18 20 22 24 26 28 30 32 Time after cold shock (hr)

  8. Ribosomal profiles of cells carrying the mutant plasmids C A pA10S pJJG02 D B pA30S pA01S

  9. LACE LowTemperature-dependentAntibiotic Effect of Truncated cspAExpression Ribosome Trapping

  10. Cold-Shock Vector Single-Protein Synthesis at low temperature without producing any other cellular proteins NMR without protein purification

  11. cspA 3’-UTR BamHI KpnI HindIII NdeI SalI Multiple cloning site Factor Xa cleavage site [His]6 cspA ORF Ap pCold (prototype) 3100bp cspA 5’-UTR T7/cspA promoter ori

  12. Induction at 15 oC with pCold I Induction at 37 oC with a T7 vector (3 hr) _______ ______ ______ _______ _______ 0 12 24 0 12 24 0 12 24 0 12 24 0 12 24 hr - + - + - + - + - + ____ ____ ____ _____ _____ WR:49 35 26 27 53 WR49 WR35 WR26 WR27 WR53 Production of C. elegans Proteins

  13. -216 kDa -132 -45.7 -32.5 -18.4 _________ __________ _________ 0 1 2 3 4 5 0 1 2 3 4 5 0 1 2 3 4 5 days WR49 WR35 WR26

  14. Expression of γINF in pcold II vector -interferon 0 1 3 6 hr at 15° C 1 mM IPTG

  15. A B cspA 3’-UTR cspA 3’-UTR BamHI BamHI NdeI NdeI Factor Xa cleavage site DB [His]6 cspA 5’-UTR cspA ORF Ap pCold I (3100bp) Ap pCold II (2900bp) cspA promoter cspA 5’-UTR cspA promoter ori ori C cspA 3’-UTR BamHI NdeI cspA 5’-UTR Ap pCold III (2900bp) cspA promoter ori

More Related