Download
slide1 n.
Skip this Video
Loading SlideShow in 5 Seconds..
Batik Malang PowerPoint Presentation
Download Presentation
Batik Malang

Batik Malang

180 Vues Download Presentation
Télécharger la présentation

Batik Malang

- - - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript

  1. Batik Malang Sebagaisalahsatuidentitasdaerah, batik mencerminkankarakterdankewibawaandaerahtersebut. Sepertidi Malang, penelitianidentitas batik sudahseringdilakukan, tapibelummendapattitikteranggambaran yang dapatditerimasemuapihak, karenamasing-masingdaerahmempunyaiketerkaitanemosikarakter, sejarahdankepercayaan. Kita mencobamengambilsatudasarbahasandari batik khaspedalaman Malang yang telahdipakaidalamupacaraadatsejaksebelumtahun 1900-an. Batik tersebutselalumempunyai motif: SidoMukti Malang denganhiasankotakputihditengah yang biasadisebutModhangKoro. Motif inidipakaisebagaiudheng (laki-laki) dansewek (perempuan) dalamacararesmiuntuksemualapisanmasyarakat. Motif yang selalumuncul, antara lain, SawatKembangPring (motif bambujawasakbarong), Dele Kecer (hijau-merah), Kembang Kopi (gambar kopi dibelahduaberwarnahitam), KembangJuwet (biru-hijau), KembangTanjung (kuning-sawomatang, bentukbungabulattengahpinggirbergerigi), KembangJeruk (coklat), KembangManggar (putih-kuning), KembangMayang (merah-kuning), danKembangPadma (teratai) (Karimun, 2007). Sedangkandi Kota Malang, inisiatifpenggalian motif batik telahdipeloporiolehKetuaPenggerak PKK denganSK no: 114/POKJA III/PKK.KMVII/2007 yang menunjuk 3 timahliuntukmenyerapaspirasimasyarakatlewatlombadesain batik (5 besar) sekaligusmelakukanpenggaliansejarahdanbudayasetempat, sehinggadiharapkandi Kota Malang akanmempunyai batik khas Kota Malang yang mampumenyuarakanwajah Kota Malang secarautuhdimasamendatang. Denganterusberusahamenggalidanmemeliharabudayaaslidarisetiapdaerah, makaidentitasbudayaasli Indonesia dapatkitalestarikan.