1 / 47

IMTECH

IMTECH. A novel vaccine construct comprising of lipidated peptide protects against Mycobacterium tuberculosis by bolstering enduring memory T cell response Javed N Agrewala, PhD, FNA CSIR-Institute of Microbial Technology Chandigarh, INDIA javed@imtech.res.in. Vaccines-Hyd-2.11..15.

kalgarin
Télécharger la présentation

IMTECH

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript

  1. IMTECH A novel vaccine construct comprising of lipidated peptide protects against Mycobacterium tuberculosis by bolstering enduring memory T cell response Javed N Agrewala, PhD, FNA CSIR-Institute of Microbial Technology Chandigarh, INDIA javed@imtech.res.in Vaccines-Hyd-2.11..15

  2. Theme of the study To develop a unique and novel construct that can function as a vaccine in TB-endemic regions, where BCG has failed

  3. Failure of BCG Despite nine decades of BCG vaccination, TB continues to be a major global health challenge. Clinical trials worldwide have proved the inadequacy of the BCG vaccine in preventing the manifestation of pulmonary TB in adults. Ironically, the efficacy of BCG is poorest in TB-endemic areas. Factors such as non-tuberculous or environmental mycobacteria and helminth infestation have been suggested to limit the efficacy of BCG. Hence, in high TB-burden regions, radically novel strategies of vaccination are urgently required. Gowthaman & Agrewala. Trends Mol Medicine 2012

  4. IMTECH Antigen presentation Recent series of studies have suggested that M. tuberculosis and environmental mycobacteria (EnM) actively inhibit bacterial antigen processing and presentation by MHC class I and class II pathways, thus slowing the emergence of protective adaptive immunity (Wolf et al. 2007; Soualhine et al. 2007; Gehring et al. 2003, Tobian et al, 2003). BCG and EnM specifically blocks the surface export of mature class II molecules on APCs (Soualhine et al. 2007). M. tuberculosis and EnM impairs in vivo antigen processing by DCs (Wolf et al. 2007). Gowthaman & Agrewala. Crit Rev Microbiol. 2014

  5. IMTECH What ever may be the reason for BCG failure!  But the fact remains that more people have been vaccinated with BCG than any other vaccine. Still tuberculosis continues to kill some 3 million people annually. 2 billion people worldwide are infected with M. tuberculosis. Thus, the protective efficacy of the BCG vaccine remains doubtful!

  6. Any vaccine that require minimum antigen processing will work in TB-endemic population

  7. Peptides can overcome the problem of antigen processing. Since they can directly bind to MHC molecules and require minimum antigen processing. Can peptide based vaccine be successful choice in TB-endemic regions?

  8. IMTECH • PEPTIDE VACCINES • Comprise of synthetic peptides that represent immunodominant epitopes • T cells and B cells epitope can be precisely selected • Epitopes are accurately defined; can avoid autoreactive portions in the antigen • Requires no or minimum processing ХFails to elicit immune response in genetically diverse human population ХRequires adjuvant

  9. Th CTL -K- I S I S I Pam2Cys -K- I S I S I Pam2Cys Th CTL -K- I S I S I Pam2Cys Schematic representation of the epitope-based vaccine candidate. The vaccine will contain Th and CTL epitopes. In all cases the T-helper (Th) epitope occupies N-terminal position and is separated from the cytotoxic T cell epitope (CTL) epitope by a single lysine (K) residue. Where lipid is attached, this is done through ε-amino group of the lysine residue such that the self-adjuvant lipid, linked through two serine residues (S), forms a branch between the Th and CTL epitope Th epitope 1: LFAAFPSFAGLRPT FDTRLM Th epitope 2: SEFAYGSFVRTVSLPVGADE Gowthaman & Agrewala. Trends Mol Medicine 2012

  10. Why peptide vaccine may be better than BCG? IMTECH Can overcome problem of antigen processing due to EM/Mtb/BCG, since no processing is required. No fear of preformed immune response generated due to exposure to BCG/EM/Mtb. Selective epitopes, can avoid autoreactive/suppressive portions in the antigen.

  11. IMTECH Whether the construct influences the maturation of DC? F91: free peptide L91: lipidated peptide

  12. Untreated F91 L91 L91 augments IL-12 production by DCs Number of conjugates T cells exposed to L91 treated DCs secreted more IFN-γ IFN-γ (pg/ml) Unstimulated L91 3 55 Medium Pam2Cys F91 L91 T Cell Proliferation Gowthaman & Agrewala. J Infect Dis. 2011

  13. L91 Enhances Activation and Maturation of DCs Medium LPS L91 P91 L91 P91 CD74 CD74 CD80 CD40 CD86 IAd IAd

  14. Whether the peptides works across MHC barriers?

  15. IMTECH Immunization L21, P21, L91, P91 [BALB/c, C57BL/6, C3He, FVB] Booster 7-14d Sacrificed 240 days In vitro challenge with peptides Free peptides were emulsified in IFA. T cell response

  16. L21 L91 P91P21 IMTECH Peptide works across MHC barriers BALB/c C57BL/6 T cell proliferation C3He FVB T cell proliferation Peptides (nmoles)

  17. L91 induces proliferation and activation of CD4 T cells Pam2Cys 4.2% Control 4.1% F91 16% L91 52% T Cell Proliferation Control Pam2Cys F91 L91 A 6 13 4 4 CD44 CD69 B CD69+ CD44+ CD4 T cells (Fold Change) Control Pam2Cys F91 L91

  18. A IFN-γ (pg/ml) Control Pam2Cys F91 L91 B TNF-α IFN-γ IFN-γ IL-4 (O.D) CD4 C IL-5 (pg/ml) D IL-10 (O.D) Immunization with L91 elicits mainly secretion of IFN-γ A Pam2Cys Medium F91 L91 8 25 8 10 B IFN-γ+ CD4 T cells (Fold Change) n.s n.s n.s Control Pam2Cys F91 L91 Control Pam2Cys F91 L91 Control Pam2Cys F91 L91 Control Pam2Cys F91 L91 Control Pam2Cys F91 L91 11 15 11 36

  19. L91 immunization evokes IL-17 secretion Medium L91 Pam2Cys F91 Immunization L91 9.9 2.6 2.3 1.4 2.0 2.4 1.5 2.8 Saline CD4 IL-17 1.5 1.4 3.1 3.4 BCG

  20. 12 11 4 3 CD44 CD62L 93 130 315 34 6 L91 immunization engenders T cell memory Control F91 L91 B Fold induction Untreated F91 L91 Central Memory Effector Memory Control F91 L91 A B CD127 (Fold induction) Control F91 L91 CD127

  21. L91 Vaccination Protects Mice Against Mtb Experimental design for protection studies in mice. Different groups of BALB/c mice were immunized with L91 or controls (F91, LH, BCG and placebo). Peptides were given at a dose of 20 nmol (primary immunization) and 10 nmol (booster). BCG (106 CFU/animal) was given as control. Mice were rested for 75 days. Animals were challenged with a low dose aerosol of M. tb H37Rv (~100 CFU/mouse) 75 days post immunization. Thirty days after infection, animals were sacrificed and studied for immune response and pathology. L91 immunization engenders better protection than BCG in mice. Mtb load in lungs was enumerated by CFU plating. Results are depicted as bar graphs with mean ± SD (log10 value). Data shown are from 3 independent experiments. '*' indicates p<0.05, '**' p<0.01, '***' p<0.001.

  22. CD44 CD62L L91 evokes enduring memory CD4 T cell response in Mtb infected mice Untreated Pam2Cys F91 L91 274 263 488 525 CD69 Untreated Pam2Cys L91 30 27 36 24 19 20 Central: CD44hi/CD6Lhi Effector: CD44hi/CD62Llo CD127 Untreated Pam2Cys L91 19 3 5

  23. L91 immunization induces better lung immunity than BCG TNF-α FoxP3 CD4 CD4 Placebo BCG F91 L91 24 22 26 32 Placebo BCG F91 L91 5 6 8 15 Placebo BCG F91 L91 5 9 6 4 Placebo BCG F91 L91 1424 2334 1175 1056 PD-1 IFN-γ

  24. L91 immunization engenders better protection than BCG in mice Log10 CFU Placebo BCG L91 F91 LH L91 immunization engenders better protection than BCG in mice. Mtb load in lungs was enumerated by CFU plating. Results are depicted as bar graphs with mean ± SD (log10 value). Data shown are from 3 independent experiments. '*' indicates p<0.05, '**' p<0.01, '***' p<0.001.

  25. A novel therapeutic strategy to reinforce the potency of drugs to kill Mycobacterium tuberculosis by concurrently bolstering host immunity by promiscuous peptide conjugated to TLR-2 agonist 20 immunization L91 (10nmol) Second dose of drug (INH 25mg/kg orally) 10 immunization L91 (20nmol) First dose of drug (INH 25mg/kg orally) Aerosol challenge (100 CFU) 4 wk 2 wk 2 wk 12 wk CFUs: lungs, spleen

  26. * * * *** ** *** * * *** ns *** Lungs (log10 CFU/g) INH+RFP in drinking water * * ns * Lungs (log10 CFU/g) INH orally with two dose

  27. *** *** *** ** *** *** ** ** *** *** *** *** *** *** ** ** IFN-γ (ng/ml) IL-17 (ng/ml) Spleen Spleen IFN-γ (ng/ml) IL-17 (ng/ml) Lungs Lungs

  28. ** ** ** * * ** ** ** * ** ** * * * ** * IFN-γ+ IL-17 + CD4 T cells (%) IFN-γ+ TNF-α + CD4 T cells (%) Spleen Spleen IFN-γ+ IL-17 + CD4 T cells (%) IFN-γ+ TNF-α + CD4 T cells (%) Lungs Lungs

  29. PBMCs of TB patients on drug therapy on in vitro stimulation with L91 induces secretion of IFN-γ *** *** *** *** IFNγ+ CD4 T Cells (%) IL-17A+ CD4 T Cells (%) ns ns

  30. Medium F4.8 Pam2Cys L4.8 2.8±0.1 2.8±0.1 3.3±0.3 10.6±1.6 IFN-γ IFN-γ 9.0±0.2 3.9±0.1 6.6±0.3 14±0.1 CD8 CD4 * *** * ** * ** IFN-γ+ CD8 T Cells (%) IFN-γ+ CD4 T Cells (%)

  31. CD45RO CD45RA L91 expands central memory pool of CD4 T cells of TB patients IMTECH Untreated 16 kDa F91 L91 3.6±1.54 n= 14 3±2.3 n= 3 4.4±2.64 n= 13 13±3.2 n= 14

  32. CFU Load of Lung 0.0178 0.0004 0.0042 0.0316 L91 Protects Guinea Pigs from Mtb better than BCG Experimental design for the protection studies in Guinea pigs. Different groups of Duncan-Hartley Guinea pigs were immunized with L91 or controls (F91, LH, BCG and placebo). Peptides were given at a dose of 100 nmol (primary immunization) and 50 nmol (booster). BCG (106 CFU/ animal) was given as a control. Animals were rested for 75 days and challenged with a low dose aerosol of M. tb H37Rv (~30 CFU/animal), 75 days post immunization. Thirty days after infection, animals were sacrificed and studied for bacterial burden and pathology.

  33. L91 immunized exhibit constrained pathology upon Mtb challenge in Guinea pigs Placebo L91 BCG F91 L91 immunized Guinea pigs exhibit constrained pathology upon M. tb challenge in Guinea pigs. The protection studies were performed as described in Fig. 3.4. Representative photomicrographs of formalin fixed H & E stained histopathology lung sections of Guinea pigs (left and center panel). Arrows indicate regions of granulomas or necrosis. Right panel shows photographs of gross pathology in lungs of immunized and infected animals. Data are representative of 2 comparable experiments with a minimum of 5 animals per group. LH

  34. Peptide2 CD4 Linker CD8 Peptide1 Pam2Cys TLR2 MHC II CM MHC I CM TLR2 CM CM MHC II CM CM CM MHC I MHC II Cytokine Receptor IFN-Y, TNFα, IL-17, IL-2 IL-6, IL-12, IFN-γ CM: Costimulatory molecule Pathogen Gowthaman & Agrewala. Trends Mol Medicine 2012

  35. CONCLUSION Lipidated peptide vaccine may be a future prophylactic strategy to eradicate TB from TB-endemic zones

  36. Juraj Ivanyi, TB & RI Unit, Hammersmith Hospital, London David Jackson, University of Melbourne, Australia Pushpa Gupta and UD Gupta, JALMA, India AK Janmeja, Government Medical College and Hospital, India IMTECH, CSIR and DBT for Financial Support

  37. THANKS

  38. IMTECH Fails to elicit immune response in genetically diverse human population! Answer: Promiscuous Peptides?

  39. 1 20 MATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGRYEVRA ELPGVDPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVRTVSLPVGADE DDIKATYDKGILTVSVAVSEGKPTEKHIQI RSTN (141 AAs) IMTECH Promiscuous Peptide Selection We generated 141 over lapping peptides from: 16kDa, 19kDa, 30kDa, 38kDa, 65kDa, CFP-10, ESAT-6 All the individuals generated robust T cell proliferation and predominant secretion of IFN-g by PBMCs of the PPD+ healthy individuals against 16 kDa (Acr1) antigen of Mtb.

  40. Identification of T-Helper Cell Activating Promiscuous Peptides • Buffy coat of 20 PPD+ healthy volunteers with no history of TB were selected and tested using promiscuous peptides for: • Peptides binding to HLA-class II molecules • T cell proliferation • Secretion of IFN-g • Agrewala et al. 1997, 1998, 1999

  41. IMTECH Peptides of sequence 21-40 and 91-110 showed permissive binding The HLA type of donors was performed by low resolution PCR with sequence-specific primers (PCR-SSP). All presenting HLA-DR-homozygous L-BCL were chosen to conform at least to the donor’s major serological, and usually to molecular, type. The affinity of the presenting MHC class II molecule for peptides p21-40 and p91-110 was determined by a competitive MHC binding assay. ++++ indicates high-affinity binding (IC50<10µM); +++ intermediate affinity (10 µM<IC50<100µM); and ++ indicates low affinity (100–1000µM). Agrewala et al. 1997, 1998, 1999

  42. IMTECH Peptides of sequence 21-40 (p21-40) and 91-110 (p91-110) showed T cell proliferation in all the tested individuals. p91-110 induces mainly secretion of IFN-g. Th1 clones (IFN-g): 90% Th0 clones (IFN-g +IL-4): 10% p21-40 promotes production of IFN-g and IL-4. Th0 clones (IFN-g + IL-4): 75% Th2 clones (IL-4): 25% p21-40: LFAAFPSFAGLRPTFDTRLM p91-110: SEFAYGSFVRTVSLPVGADE Agrewala et al. 1997, 1998, 1999

  43. Peptides are weak immunogens! Can conjugation with Pam2Cys increase the immunogenecity of peptides?

  44. IMTECH Why Pam2Cys? S-[2,3-is(palmitoyloxy)propyl]cysteine Ligand for TLR2, induces signaling through it. Has self-adjuvanting properties when conjugated with peptides. Induces robust Th1 and Th17 type immune responses. Long-term protective effect. Potent immunogenicity can be explained by its ability to mature and activate dendritic cells(suggesting that vaccines containing this lipid moiety may interact directly with DCs to promote immune responses). Jackson et al. 2004, Zhu et al. 2004, Düesberg et al. 2002, Zeng et al. 2002

  45. IMTECH Why TLR2? Incorporating the Pam2Cys into peptide structures effectively triggers the TLR2 and secretion of IL-12 by DCs. TLR2 is copiously present on DCs, monocytes, and lung epithelia. Jackson et al. 2004, Zhu et al. 2004, Düesberg et al. 2002, Zeng et al. 2002

  46. Why DCs? IMTECH DCs are decisive for efficient immune response. Only cells, capable of activating naïve T cells. Skews immune response towards Th1 and Th17 cells. Constitutive expression of MHCs and costimulatory molecules.

  47. Advantage of Vaccine IMTECH Totally synthetic No adjuvant is required Can activate CD4 and CD8 T cells Skews immune response to Th1 and Th17 type Can activate naïveT cells

More Related