kamala
Uploaded by
51 SLIDES
823 VUES
520LIKES

CIS 595 Bioinformatics

DESCRIPTION

CIS 595 Bioinformatics. Lecture 2 Introduction to Bioinformatics A number of slides taken/modified from: Russ B. Altman (http://www.smi.stanford.edu/projects/helix/bmi214/) Patrik Medstrand (www.cmb.lu.se/devbiol/bioinfo/ old/download/intro2003/databases_handouts.pdf)

1 / 51

Télécharger la présentation

CIS 595 Bioinformatics

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. CIS 595 Bioinformatics Lecture 2 Introduction to Bioinformatics A number of slides taken/modified from: Russ B. Altman (http://www.smi.stanford.edu/projects/helix/bmi214/) Patrik Medstrand (www.cmb.lu.se/devbiol/bioinfo/ old/download/intro2003/databases_handouts.pdf) Mark Gerstein (http://bioinfo.mbb.yale.edu/mbb452a/2002/sequences2002.pdf)

  2. What is Bioinformatics? • Every application of computer science to biology • Sequence analysis, images analysis, sample management, population modeling, … • Analysis of data coming from large-scale biological projects • Genomes, transcriptomes, proteomes, metabolomes, etc…

  3. The New Biology • Traditional biology • Small team working on a specialized topic • Well defined experiment to answer precise questions • New “high-throughput” biology • Large international teams using cutting edge technology defining the project • Results are given raw to the scientific community without any underlying hypothesis

  4. Examples of “High-Throughput” • Complete genome sequencing • Simultaneous expression analysis of thousands of genes (DNA microarrays, SAGE) • Large-scale sampling of the proteome • Protein-protein analysis large-scale 2-hybrid (yeast, worm) • Large-scale 3D structure production (yeast) • Metabolism modeling • Biodiversity

  5. Role of Bioinformatics • Control and management of the data • Sequence, Structure and Function analysis • Analysis of primary data e.g. • Mass spectra analysis • DNA microarrays image analysis • Statistics • Database storage and access • Interpreting results in a biological context

  6. Sequence, Structure and Function Analysis In order to gather insight into the ways in which genes and gene products (proteins) function perform: • SEQUENCE ANALYSIS: Analyze DNA and protein sequences, searching for clues about structure, function, and control. • STRUCTURE ANALYSIS: Analyze biological structures, searching for clues about sequence, function and control. • FUNCTION ANALYSIS: Understand how the sequences and structures leads to the functions.

  7. Evolution and Bioinformatics • Common descent of organisms implies that they will share many “basic technologies.” • Development of new phenotypes in response to environmental pressure can lead to “specialized technologies.” • More recent divergence implies more shared technologies between species. • All of biology is about two things: understanding shared or unshared features.

  8. Biology is Fundamentally Information Science Where is information: • DNA Sequences • GENBANK release 128 (2/02) contains 17,089,143,893 bases in 1,546,532 sequences • Protein Sequences • PIR or Swiss-prot (as of 3/02); 106,736 sequences, 39,242,287 total amino acids • Protein 3D Structures • Protein Data Bank (PDB), as of March 2002: 17,679 Coordinate Entries; 15,855 proteins, 1060 nucleic acids, 746 protein/nucleic acid complex 18 carbohydrates

  9. Biology is Fundamentally Information Science Where is information: • Online access to DNA microarray data • http://smd.stanford.edu/; 10,000 to 40,000 genes per chip; Each set of experiments involves 3 to 100 “conditions” • Medical Literature on line. • Online database of published literature since 1966 = Medline = PubMED resource 4,600 journals 11,000,000+ articles (most with abstracts) • ETC…

  10. Topics • Sequence Alignment; Sequence Motifs; Gene Finding • Computing with Biological Structures • Phylogenetic Algorithms • Microarray Data Analysis • Genetic Networks • Comparative Genomics • Proteomics • Biological Ontologies; Biological Text Mining

  11. Sequence Alignment • What is sequence alignment? • Given two sequences and a scoring scheme find the optimal pairing of letters. RKVA--GMAKPNM RKIAVAAASKPAV • Why align sequences? • A few sequences with known structure and function; much more with unknown properties. • If one of them has known structure/function, then alignment to the other yields insight about another • Similarity may be used as evidence of homology, but does not necessarily imply homology

  12. Sequence Alignment Types of alignment: • Local vs. global; • Pairwise vs. multiple d1dhfa_ LNCIVAVSQNMGIGKNGDLPWPPLRNEFRYFQRMTTTSSVEGKQ-NLVIMGKKTWFSI d8dfr__ LNSIVAVCQNMGIGKDGNLPWPPLRNEYKYFQRMTSTSHVEGKQ-NAVIMGKKTWFSI d4dfra_ ISLIAALAVDRVIGMENAMPWN-LPADLAWFKRNTL--------NKPVIMGRHTWESI d3dfr__ TAFLWAQDRDGLIGKDGHLPWH-LPDDLHYFRAQTV--------GKIMVVGRRTYESF

  13. Sequence Alignment How to measure the alignment quality? • Define scoring matrix (PAM250)

  14. Sequence Alignment Alignment algorithms: • dot matrix • dynamic programming • Fasta, • Blast, • Psi-Blast; • Clustal Similarity strength: • Percent identity • E-value (statistical measure)

  15. Sequence Alignment

  16. Sequence Motifs • A subsequence that occurs in multiple sequences with a biological importance. • Protein motifs often result from structural features • DNA sequences that provide signals for protein binding or nucleic acid folding

  17. Sequence Motifs • PROSITE Database a collection of motifs (1135 different motifs): • A manually created collection of regular expressions associated with different protein families/functions. • Globin sequence signature (PDOC00933): F-[LF]-x(5)-G-[PA]-x(4)-G-[KRA]-x-[LIVM]-x(3)-H

  18. Gene Finding • Problem : Identify the genes within raw genomic DNA sequence • Input: Raw DNA sequence • Output: Location of gene elements in the raw sequence (including exons, introns, other sequence annotations)

  19. Topics • Sequence Alignment; Sequence Motifs; Gene Finding • Computing with Biological Structures • Phylogenetic Algorithms • Microarray Data Analysis • Genetic Networks • Comparative Genomics • Proteomics • Biological Ontologies; Biological Text Mining

  20. Computing with Biological Structures • General Issues • How do we represent structure for computation? • How do we compare structures? • How can we summarize structural families?

  21. Computing with Biological Structures Applications: • Structure alignment • Build fold library Hb Alignment of Individual Structures Fusing into a Single Fold “Template” Mb

  22. Computing with Biological Structures Why align structures: • Provides the “gold standard” for sequence alignment • For nonhomologous proteins, identify common substructures of interest • Classify proteins into clusters, based on structural similarity (SCOP)

  23. Computing with Biological Structures Applications: • Predicting RNA Secondary Structure (the MFOLD Program http://www.bioinfo.rpi.edu/applications/mfold/old/rna/)

  24. Computing with Biological Structures Protein secondary structure prediction Sequence RPDFCLEPPYTGPCKARIIRYFYNAKAGLVQTFVYGGCRAKRNNFKSAEDAMRTCGGA Structure CCGGGGCCCCCCCCCCCEEEEEEETTTTEEEEEEECCCCCTTTTBTTHHHHHHHHHCC

  25. Topics • Sequence Alignment; Sequence Motifs; Gene Finding • Computing with Biological Structures • Phylogenetic Algorithms • Microarray Data Analysis • Genetic Networks • Comparative Genomics • Proteomics • Biological Ontologies; Biological Text Mining

  26. Phylogenetic Algorithms Why build evolutionary tree? • Understand the lineage of different species. • Have an organizing principle for sorting species into a taxonomy • Understand how various functions evolved. • Understand forces and constraints on evolution. • To do multiple alignment.

  27. Phylogenetic Algorithms Multiple Alignment and Trees • Progressive alignment methods do multiple alignment and evolutionary tree construction at the same time. • Sequence alignment provides scores which can be interpreted as inversely related to distances in evolution. • Distances can be used to build trees. • Trees can be used to give multiple alignments via common parents.

  28. Topics • Sequence Alignment; Sequence Motifs; Gene Finding • Computing with Biological Structures • Phylogenetic Algorithms • Microarray Data Analysis • Genetic Networks • Comparative Genomics • Proteomics • Biological Ontologies; Biological Text Mining

  29. Microarray Data Analysis Experimental Protocol

  30. Microarray Data Analysis

  31. Microarray Data Analysis What are expression arrays good for? • Follow population of (synchronized) cells over time, to see how expression changes (vs. baseline). • Expose cells to different external stimuli and measure their response (vs. baseline). • Take cancer cells (or other pathology) and compare to normal cells. • (Also some non-expression uses, such as assessing presence/absence of sequences in the genome)

  32. Microarray Data Analysis Preprocessing Score differential hybridization Merging replicate experiments Background correction Cy5/Cy3 normalization Data input Duplicate spot variability Replicate experiment variability Spot quality Artifactual regions

  33. Microarray Data Analysis Convert microarray images to data

  34. Microarray Data Analysis Clustering: • If two genes are expressed in the same way, they may be functionally related. • If a gene has unknown function, but clusters with genes of known function, this is a way to assign its general function. • We may be able to look at high resolution measurements of expression and figure out which genes control which other genes. • E.g. peak in cluster 1 always precedes peak in cluster 2 => cluster 1 turns cluster 2 on?

  35. Microarray Data Analysis Classification: • Uses known groups of interest (from other sources) to • learn the features associated with these groups in the primary data, • create rules for associating the data with the groups of interest. • Often called “supervised machine learning.”

  36. Topics • Sequence Alignment; Sequence Motifs; Gene Finding • Computing with Biological Structures • Phylogenetic Algorithms • Microarray Data Analysis • Genetic Networks • Comparative Genomics • Proteomics • Biological Ontologies; Biological Text Mining

  37. Genetic Networks What is a genetic network? • Individual genes have a function (e.g. transforming a substance or binding to a substance) • Sets of functions when sequenced can produce pathways (e.g. output of one transformation is the input to another) • Sets of pathways, as they interact with other pathways, create a genetic network of interactions.

  38. Genetic Networks Reconstructing Genetic Regulatory Networks: • Hard problem. • Given N genes, there are an exponential number of connections between the genes. • Relationships are not generally +/- but are but are continuous valued. • Must use knowledge about expected function and membership in pathways to prune the list of possible network interactions.

  39. Topics • Sequence Alignment; Sequence Motifs; Gene Finding • Computing with Biological Structures • Phylogenetic Algorithms • Microarray Data Analysis • Genetic Networks • Comparative Genomics • Proteomics • Biological Ontologies; Biological Text Mining

  40. Comparative Genomics • Large scale comparison of genomes to • understand the biology of individual genomes • extract general principles applying to groups of genomes. • Assumption: • many biological sequences, structures, and functions are shared across organisms, • the signal from these organisms can be increased by combining them in analyses.

  41. Comparative Genomics Important issues for Comparative Genomics • Aligning very large sequences • Comparative approaches to gene finding • Comparative approaches to assigning function • Comparative approaches to identifying key regulatory regions

  42. Comparative Genomics Example: Assigning protein functions

  43. Topics • Sequence Alignment; Sequence Motifs; Gene Finding • Computing with Biological Structures • Phylogenetic Algorithms • Microarray Data Analysis • Genetic Networks • Comparative Genomics • Proteomics • Biological Ontologies; Biological Text Mining

  44. Proteomics • What is PROTEOMICS? • -OMICS has become the suffix to denote the study of the entire set of something • Genomics: study of all genes • Proteomics: study of all proteins • Transcriptomics: study of all mRNA transcripts • Metabolomics: study of metabolites in cell

  45. Proteomics Proteomics questions • Which proteins are made from the genome? • What is their 3D structure? • Where they are? • What they do? • Which other proteins they interact with? • Are they modified in the cell post-translationally?

  46. Proteomics Key proteomic technologies • 3D structure determination (X-ray/NMR) • 2D Gels to assess all the proteins in a cell. • Mass spectrometry to identify proteins, protein modifications. • Yeast-Two-Hybrid systems to assess protein-protein interactions • Protein Arrays to assess all proteins in a cell using antibodies or other recognition technology.

  47. Topics • Sequence Alignment; Sequence Motifs; Gene Finding • Computing with Biological Structures • Phylogenetic Algorithms • Microarray Data Analysis • Genetic Networks • Comparative Genomics • Proteomics • Biological Ontologies; Biological Text Mining

  48. Biomedical Ontologies • In order to communicate effectively we need: • common language • basic knowledge • Example: • Metabolic Pathways: • language: names of products, enzymes, substrates and pathways • knowledge: what is a reaction, how do enzymes and substrates participate, what are the legal components of a pathway

  49. Biomedical Ontologies Gene Ontology (http://www.geneontology.org/) • Used to classify gene function. • A controlled listing of three types of function: • Molecular Function • Biological Process • Cellular Component

  50. Biological Text Mining • Literature in Biomedicine • Much literature generated quickly. • 11 million citations in MEDLINE. • 400,000 added yearly. • Need methods to deal with data. • Query • Summarize • Organize • Understand

More Related
SlideServe
Audio
Live Player
Audio Wave
Play slide audio to activate visualizer