leda
Uploaded by
29 SLIDES
421 VUES
290LIKES

European Access to Ion Technologies - SPIRIT Project Update

DESCRIPTION

Learn about SPIRIT's 3-year status and accomplishments in ion beam physics and materials research. Explore workshops, tutorials, and joint research activities enhancing ion technologies across Europe.

1 / 29

Télécharger la présentation

European Access to Ion Technologies - SPIRIT Project Update

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. NuPECC Meeting Copenhagen, June 2012 SPIRIT 3-Year STATUs Wolfhard Möller Institute of Ion Beam Physicsand Materials Research Helmholtz-Zentrum Dresden-Rossendorf Dresden, Germany

  2. European Access to Ion Technologies www.spirit-ion.eu Coordinatedby • 11 Partners from 6 European Member States and 2 Associated States • Free Access for European Users at9 European Ion Beam Laboratories • Development of Ion Technologies for Materials Analysis andModification • Promotingand Training Activities

  3. The SPIRIT Consortium U Surrey KU Leuven HZDR Dresden UBW Munich CEA Caen/ Saclay UPMC Paris RBI Zagreb ETH Zurich JSI Ljubljana CNRS/U Bordeaux ITN Lisbon

  4. The HZDR Ion Beam Centre

  5. SPIRIT Dates and Numbers Project Duration 1-March-2009 – 28-Febr-2013 Prolongation envisaged – 31-Aug-2013 Total EC Funding6.991.000 € Total User Time > 13.000 h Distribution of Budget Distribution ofActivities ● All activitieswell on track ● Very positive Midterm Evaluation in 2011

  6. European Access to Ion Technologies SPIRIT offers • Ion-beam based quantitative materialsanalysisRutherford backscattering (RBS) ElasticRecoilDetection (ERD) NuclearReaction Analysis (NRA) Proton-induced X-rayemission (PIXE) …. • Ion-beam modificationofmaterialsConventionalionimplantation Plasma-basedionimplantation Ion-assistedthinfilmdeposition • Ion irradiationNuclearmaterials Biological cells ….

  7. SPIRIT Transnational Access (TNA) • total usertime tobedelivered ~13000 hrs Origin of Users

  8. SPIRIT Transnational Access (TNA) • total deliveryofuser time will exceedtheinitiallyprojectedoneby > 5%

  9. SPIRIT Networking • Workshops andTutorials (internalandexternalparticipants) • Tutorial "Ion Implantation and Irradiation", Dresden, Germany, Dec 2009 • Tutorial "Ion Beam Surface Analysis", Zurich, Switzerland, June 2011 • Tutorial "High-resolution DepthProfiling", Paris, France, June 2011 • Tutorial "Live CellMicro-irradiation", Lisbon, Portugal, July 2012 • Workshop "New Detector Technologies forAdvanced Materials Research using Ion Beam Analysis", PlitviceLakes, Croatia, Oct 2010 • Workshop"High-resolution DepthProfiling", Paris, France, June 2011 • Workshop "Ion Beamsas a Tool for Nanotechnology", Lisbon, Portugal, July 2012 • Technician Exchange Program • Standards and Round Robin Actions • Ion Beam Analysis • Implantation FluenceControl • Cell Irradiation Protocols

  10. SPIRIT Joint “Research” Activities (JRA) • Beams • Targeted Irradiation • In-situ Instrumentation • Improving Analysis • Detector Development • ReductionofAnalysing Beam Effects • Extendinginto New Fields • 3-dimensional Analysis • Chemical andMolecular Imaging

  11. Targeted Irradiation UBW / TU Munich • Living cellirradiation • Beam exitwindow • Single iondetection • in-situ microscopy • small beam spot (~ 500 nm) • high targetingaccuracy (~ 1 μm) Irradiation of HeLa cells with 55 MeV carbon ions at. g-H2AX foci (green) indicate the position of strand breaks.

  12. In-situ Instrumentation • Fast RBS Analysis duringAnnealing • Ruggedized PIPS detector • Fast dataacquisition KU Leuven Thermal reactionof a Ni+7%Pt thinfilmwiththe Si substrate

  13. Dectector Development: Segmented PIPS • Large detectorarea • reduces time ofanalysis • reducesirradiationdamageof sample • deterioratesenergyresolution due tokinematicspread HZDR Dresden UPMC Paris

  14. Detector Development: 2D position sensitive • Useof X-rayequipment • 1.5x1.5 cm2TimePixdetector • 256x256 pixel • Energyresolution (MeVα) ~60 keV • Lateral resolution ~10 μm ITN Lisbon Blockingpattern of 2 MeV 4He particlesbackscatteredfrom6H-SiC andbest fit by collisional Monte Carlo simulation

  15. Small, high-resolution gas ionization detectors ETH Zurich RBI Zagreb • noradiationdegradation • very high heavy ionenergyresolutionMeVprotons 11 keV 72 MeVXeions 1.4 % • miniaturizedversionavailable

  16. 3D Analysis using Confocal PIXE • 2D lateral resolutionby beam scanning • depthresolution ~20 μmbyfocused X-raycollection JSI Ljubljana Tomography of a gunshot residue microparticle using confocal PIXE analysis

  17. Chemical analysis: High-resolution PIXE wavelengthdispersiveanalysisusingcrystalspectrometer RBI Zagreb S. Fazinic et al., J. Anal. At. Spectr. 26(2011)2467

  18. Chemical Analysis: MeV SIMS • Molecular Mapping • "Soft" electronic desorption: moreintact large molecules • Simultaneous RBS and PIXE analysis • Option ofoperationatambientpressure Univ. Surrey leucine (aminoacid)

  19. Multi- andInterdisciplinary User Research • Materials Research Nanosystems • Biomedical R&D Tissue-materials interaction Radiation biology • Environmental InvestigationsPollution Remedy • Cultural Heritage Studies Environmental & Cultural Heritage (12%) Materials (81%) Biomedical (7%) Materials (81%)

  20. Jet Sputtering by Electronic Energy Loss • Very high sputteringyield • Modified thermal spikedescription User Marcel Toulemonde GANIL-CIRIL Caen, France Heavy ionirradiation 200 MeV Au+ Infrastructure UBW/TU Munich Sputteredclusters on catcher Thermal componentandjetcomponent

  21. Highlychargedioninteractionwithsurfaces 40 keV Xe25+ 1 µm x 1 µm • Pit formation • Monatomicheight • Very high sputteryield • Synergyofkineticand potential energy User W. Meissl et al. UT Vienna KBr (100) Infrastructure HZDR Dresden HZDR Dresden UT Vienna F. Aumayr et al., J. Phys. Condens. Matter23(2011)393001

  22. Dopantdiffusion in Ge • Gepreferableto Si due to high carriermobility • Largely different material properties d-doping with B by MBE Diffusion duringannealing after ionirradiation User Elena Bruno MATIS IMM-CNR Catania, Italy Enhanced borondiffusion after oxygenionbombardment Peculiar non-Gaussiandiffusionprofiles Influenceof GeO2nanoclusterformation Infrastructure Univ. Surrey G.G. Scapellato et al., Phys. Rev. B 84(2011)024104

  23. Stability of EUV optical multilayers • EUV reflectionopticsforspacemissions • deteriorationby solar wind Mo/Simultilayer 1 keV H+ irradiation User M.G. Pelizzo CNR-PN Padova, Italy Infrastructure HZDR Dresden SiO2/Sicapping Ir/Sicapping after before Significantloss in low-wavelengthreflectivitydepending on architecture M.G. Pelizzo et al., Optics Express 19(2011)14838

  24. Ion Beam Analysis forForensicApplications • Wherehasthevictim / thesuspectedbeen? • Information byanalysisofsandgrains Simulatedcriminalcase Canonicaldiscriminantfunctionsfromelementaldistributions PIXE / PIGE microanalysis User S. Calusi Univ. and INFN Firenze, Italy Infrastructure Univ. Surrey K Ti Fe Cr Reliableidentificationofprovenance M.J. Bailey et al., Anal. Chem. 84(2012)2260

  25. NiTi for prosthetic implants • Superelasticity • Shape-Memory Effects • But: BiotoxicityofNi User Rui Martins Inst. Tecnol. e NuclearLisbon, Portugal Plasma Immersion Implantation 20...40 keV N++ O+ O+ N+ Infrastructure HZDR SurfacelayerstronglydenudedofNi

  26. Bioapplications of Nanomaterials • Magneticnanoparticlesareusedascontrastagents in magneticresonanceimaging • Interaction ofmagneticnanoparticlesandcells ? • Toxicity ? User Giacomo Ceccone EC Joint Research CentreIspra, Italy PIXE Cytosol Nucleus Infrastructure CNRS-CENBG Optical Fe C Nanoparticlesdecoratetheperinuclearregionofthecell

  27. Phytoremediation of Agricultural Pollutants • Localizationofnutritionelementsandmetals in plants • Defencemechanismsagainstuptake User LyudmillaLyubenova Helmholtz Zentrum München, Germany μPIXE Infrastructure JSI Ljubljana L. Lyubenova et al., Metallomics4(2012)333

  28. Photocatalytic Thin Films • TiO2 (anatase) for environmental decontamination • N dopingforactivationbyvisible light • Thinfilmdeposition: Reactive DC magnetronsputteringwith N codoping User NunoBarradasInst. Tecnol. e NuclearLisbon, Portugal HI-ERD Infrastructure HZDR Surprise: thereis Na in thefilms (fromglasssubstrate)Surprise: thereismore C than N in thefilms

  29. Industrial Applicationsand Services • SPIRIT: onlylittleindustrialuse3 of ~190 proposalsHowever: significantindustrialservicesat SPIRIT partners (upto ~30% of total activities) • Industrial criteriaNon-disclosure: nopeerreviewing! Fast deliveryNearbypartnership(mostly) Quality control(ISO certification?) Bilateral cooperationorpurchasecontractspreferred • MultidisciplinaryApplicationsIon beam materialsanalysis Ion implantation

More Related