ossie
Uploaded by
58 SLIDES
967 VUES
590LIKES

Database Searching

DESCRIPTION

Database Searching. BLAST and FastA. Database Homology Searching. Use algorithms to increase efficiency and provide a mathematical basis for searching which can be translated into statistical significance Assumes that sequence, structure and function are interrelated.

1 / 58

Télécharger la présentation

Database Searching

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. Database Searching BLAST and FastA

  2. Database Homology Searching • Use algorithms to increase efficiency and provide a mathematical basis for searching which can be translated into statistical significance • Assumes that sequence, structure and function are interrelated. • BLAST (Basic Local Alignment Tool) and FastA (Fast Alignment) • These are heuristic methods approximating Smith Waterman

  3. What is a Heuristic Method? • Many problems in Artificial Intelligence are optimization problems. • An approximation (or heuristic) search method does not mean that the search algorithm will find a wrong solution. • If a solution is found, that solution is guaranteed to be valid, but it may not be optimal.

  4. BLAST • The BLAST algorithm was written balancing speed and increased sensitivity for distant sequence relationships. • Instead of relying on global alignments (commonly seen in multiple sequence alignment programs) BLAST emphasizes regions of local alignment to detect relationships among sequences which share only isolated regions of similarity.

  5. BLAST • Blast creates a list of all short sequences (words) that have a certain “threshold” score when compared with the query sequence. • These are 16-256 nucleotides or 3 amino acids in a row. • Then the database is searched for occurrences of these words. • Find this in BLAST algorithm Parameters

  6. BLAST Speed is achieved by: • Pre-indexing the database before the search • Parallel processing • Uses a hash table that contains neighborhood words rather than just random words.

  7. Neighborhood words • The program declares a hit if the word taken from the query sequence has a score >= T when a scoring matrix is used. • This allows the word size (W (this is similar to ktup value)) to be kept high (for speed) without sacrificing sensitivity. • If T is increased by the user the number of background hits is reduced and the program will run faster

  8. Comparison Matrices In general, the BLOSUM series is thought to be superior to the PAM series for detecting evolutionarily distant sequences to the because they are derived from areas of conserved sequences. It is important to vary the parameters when performing a sequence comparison. Similarity scores for truly related sequences are usually not sensitive to changes in scoring matrix and gap penalty. Thus, if your “hits list” holds up after changing these parameters you can be more sure that you are detecting similar sequences.

  9. High Scoring Pairs

  10. BLAST • Matching words are extended into ungapped local alignments between query sequence and the database sequence. • Extensions are scored until the alignment score drops below a threshold. • The maximal-scoring segment pairs (MSPs) are combined where possible into local alignments.

  11. Statistical Significance of Sequence Comparisons • Assess the statistical significance of a particular global alignment by generating many random sequence pairs of the appropriate length and composition, and calculating the optimal alignment score for each.

  12. BLAST Statistics • A local alignment without gaps consists simply of a pair of equal length segments, one from each of the two sequences being compared. • A modification of the Smith-Waterman or Sellers algorithms finds segment pairs whose scores can not be improved by extension or trimming. • These are called high-scoring segment pairs or HSPs.

  13. Local Alignment Statistics • Fortunately statistics for the scores of local alignments, unlike those of global alignments, are well understood. • This is particularly true for local alignments lacking gaps, which we will consider first. • Such alignments were precisely those sought by the original BLAST database search programs.

  14. Two BLASTs • WU-Blast and NCBI Blast. • Both have some versions in the public domain, but there are private versions of WU Blast. • TIGR, Berkeley Drosophila Genome and Stanford’s yeast genome use WU-Blast • WU-Blast may be better for searching genomic sequences- different gap scoring and repeat policies.

  15. Scoring Matrix • The most critical parameter in sequence comparison is definitely the choice of a scoring matrix. • Scoring matrices reflect the knowledge about the objects which constitute the sequences. • The algorithm regard sequences merely as a list of symbols. • The meaning of the symbols for the application and their properties with regard to mutual similarity is merely represented by the content of the scoring matrices.

  16. A Good Scoring Matrix Site • http://www.techfak.uni-bielefeld.de/bcd/Curric/PrwAli/nodeD.html#wm2

  17. Log-Odds-Matrix • Frequently scores are calculated as log-odds-ratios which are based on the comparison of frequencies in sequences having the property to be studied and random frequencies.

  18. BLOSUM 62 is the default matrix in BLAST 2.0. • You can select a different matrix for your Blast search. • Though it is tailored for comparisons of moderately distant proteins, it performs well in detecting closer relationships. • A search for distant relatives may be more sensitive with a different matrix.

  19. BLOSUM 62 • The BLOSUM 62 matrix shown here is a 20 x 20 matrix of which a section is shown here in which every possible identity and substitution is assigned a score based on the observed frequencies of such occurrences in alignments of related proteins. • Identities are assigned the most positive scores. • Frequently observed substitutions also receive positive scores and seldom observed substitutions are given negative scores.

  20. BLAST • BLAST is more than a tool to view sequences aligned with each other or to calculate percent homology, but a program to locate regions of sequence similarity with a view to comparing structure and function.

  21. BLASTP • Compares an amino acid query sequence against a protein sequence database.

  22. BLASTN • Compares a nucleotide query sequence against a nucleotide sequence database.

  23. BLASTX • Compares a nucleotide query sequence translated in all reading frames against a protein sequence database. • You could use this option to find potential translation products of an unknown nucleotide sequence.

  24. TBLASTX • Compares the six-frame translations of a nucleotide query sequence against the six-frame translations of a nucleotide sequence database. • The tblastx program cannot be used with the nr database on the BLAST Web page because it is computationally intensive.

  25. TBLASTN • Compares a protein query sequence against a nucleotide sequence database dynamically translated in all reading frames. • We can try this search with this sequence: Hadrurin GILDTIKSIASKVWNSKTVQDLKRKGINWVANKLGVSPQAA

  26. PHI-BLAST • Pattern Hit Initiated Blast • PHI-Blast uses protein motifs to increase the chance of finding biologically significant matches.

  27. PSI-BLAST • Position Specific Iterative Blast • PSI-Blast uses an iterative alignment procedure to develop position specific scoring matrices which increases its capability to detect weak pattern matches.

  28. FastA Format • A sequence in FASTA format begins with a single-line description, followed by lines of sequence data. • The description line is distinguished from the sequence data by a greater-than (">") symbol in the first column. • It is recommended that all lines of text be shorter than 80 characters in length.

  29. Evaluating Blast Results • A Blast search can produce dozens or hundreds of candidate alignments. • Out of these alignments, which are really specific? • Raw Scores, Bit Scores and E-values are used as statistics.

  30. Raw Scores • Raw scores are the sum of scores of the MSPs that make up the alignment. • Because of differences between scoring matrices, they are not always directly comparable. • The raw score S for an alignment is calculated by summing the scores for each aligned position and the scores for gaps. • In this figure, a DNA alignment is shown. In amino acid alignments, the score for an identity or a substitution is given by the specified substitution matrix

  31. Bit Scores • Bit scores are raw scores converted from the log base of the scoring matrix that creates the alignment to log base 2. • This rescaling allows scores to be compared between the alignments.

  32. E-values • E-values (Expect values) provide information about the likelihood that a given sequence alignment is significant. • The smaller the E-value, the less likely the alignment was by chance. • At some point, you are just generating random junky data- unless you have other information like a structural comparison.

  33. FASTA • Another method for local sequence alignment. • Maintained by Dr. William Pearson at the University of Virginia. • http://www.infobiogen.fr/doc/Fasta/docfasta.html

  34. FASTA (Pearson and Lipman 1988) • This is a combination of word search and Smith-Waterman algorithm • The query sequence is divided into small words of certain size. • The initial comparison of the query sequence to the database is performed using these “words”. • If these “words” are located on the same diagonal in an array the region surrounding the diagonals are analyzed further. • Search time is only proportional to size of database not (database*query sequence)

  35. FASTA Algorithm • FASTA ktups are shorter than BLAST words. • 1-2 for proteins and 4-6 for nucleic acids. • Lower ktups give a more slower, more sensitive search. • Higher ktups give a faster search with fewer false positives.

  36. The FASTA program is the uses Hash tables. These tables speed the process of word search. Query Sequence = TCTCTC 123456 (position number) Database Sequence = TTCTCTC 1234567 (position number) You choose to use word size = 4 for your table (total number of words in your table is 44 = 256) Sequence (total of 256) ? Position w/in query Position w/in DB Offset (Q minus DB) TCTC 1,3 2,4 -1 or -3 or 1 CTCT 2 3 -1 TTCT 1

  37. FASTA Steps 2 Different offset values 1 Identical offset values in a contiguous sequence Diagonals are extended Local regions of identity are found Rescore the local regions using PAM or Blos. matrix 4 3 Create a gapped alignment in a narrow segment and then perform S-W alignment Eliminate short diagonals below a cutoff score

  38. Summary of FASTA steps 1. Analyzes database for identical matches that are contiguous (between 5 and 10 amino acids in length (same offset values)). 2. Longest diagonals are scored again using the PAM matrix (or other matrix). The best scores are saved as “init1” scores. 3. Short diagonals are removed. 4. Long diagonals that are neighbors are joined. The score for this joined region is “initn”. This score may be lower due to a penalty for a gap. 5. A S-W dynamic programming alignment is performed around the joined sequences to give an “opt” score. Thus, the time-consuming S-W step is performed only on top scoring sequences

  39. The ktup value • The ktup (for k-tuples) value stands for the length of the word • used to search for identity. • For proteins a ktup value of 3 would give a hash table of 203 • elements (8000 entries). • The higher the ktup value the less likely you will get a match unless it is identical (remember the dot plots). • The lower the ktup value the more background you will have • The higher the ktup value the faster analysis (fewer diagonals). The following rules typically apply when using FASTA:

  40. Gap Penalties • If too high a gap penalty is used relative to the range of scores in the substitution matrix, then gaps will never appear in the alignment. • Conversely, if the gap penalty is too low compared to the matrix scores, then gaps will appear everywhere in the alignment in order to align as many of the same characters as possible.

  41. ktup analysis____________________ 1 proteins- distantly related 2 proteins- somewhat related (default) 3 DNA-default

  42. FASTA Versions FASTA-nucleotide or protein sequence searching FASTx/-compares a translated DNA query sequence FASTy to a protein sequence database (forward or backward translation of the query) tFASTx/-compares protein query sequence to tFASTy DNA sequence database that has been translated into three forward and three reverse reading frames

  43. FASTA Statistical Significance A way of measuring the significance of a score considers the mean of the random score distribution. The difference between the similarity score for your single alignment and the mean of the random score distribution is normalized by the standard deviation of that random score distribution. This is the Z-score. Higher Z-scores are better because the further the real score is from this mean (in standard deviation units) the more significant it is.

  44. FASTA Statistical Significance Z score for a single alignment= (similarity score - mean score from database) standard deviation from database  ( scores)2  scores2 - Stand. Dev. = Total#ofSequences Total#ofSequences

  45. Mean similarity scores of complete database Mean similarity scores of related records

More Related