Python in Healthcare

Aug 28, 2025

0 likes | 1 Vues

We have always known python as an object-oriented, high-level programming language with dynamic semantics. It has attracted users from different platforms for its advantages in rapid application development and its dynamic building options. Little did we know that it is considered to be one of the u201csafestu201d programming languages too apart from all the popularity because of its functionality. Also, Python plays an important role in the healthcare sector.<br>

Share Presentation

Embed Code

Link

sahil_65

Télécharger la présentation

Python in Healthcare

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript

Lists in Python

Lists in Python. What is a List?. An ordered set of values: Ordered: 1 st , 2 nd , 3 rd , … Values: can be anything, integers, strings, other lists List values are called elements . A string is an ordered set of characters so it is “like” a list but not exactly the same thing.

630 views • 25 slides

Strings in Python

Strings in Python. Where have we seen strings before?. #string type variables s = “ hello” #obtaining keyboard input from the user choice = input(“ Please enter your name”) #printing text out to the screen print(s, choice). Where do we use strings? . Everywhere! http://www.google.com

643 views • 16 slides

Search in Python

Search in Python. Chapter 3. Today ’ s topics. Norvig ’ s Python code What it does How to use it A worked example: water jug program What about Java?. Overview. To use the AIMA python code for solving the two water jug problem (WJP) using search we ’ ll need four files

272 views • 12 slides

Strings in Python

Strings in Python. String Methods. String methods. You do not have to include the string library to use these! Since strings are objects, you use the dot notation (like in graphics)

800 views • 8 slides

Strings in Python

Strings in Python. Creating a string. Creating a string. There are many different ways to create a string The simplest way is to hard code it into your program mystring = “Hello”

229 views • 4 slides

Strings in Python

Strings in Python. 0. G. A. 1. T. 2. T. 3. 4. A. C. 5. A. 6. Computers store text as strings. >>> s = "GATTACA". s. Each of these are characters. Why are strings important?. Sequences are strings ..catgaaggaa ccacagccca gagcaccaag ggctatccat.. Database records contain strings

981 views • 17 slides

Decisions in Python

Decisions in Python. Boolean functions. A Boolean function. This is a function which returns a bool result (True or False). The function can certainly work with any type of data as parameter or local variable, but the result is bool .

218 views • 7 slides

Selection in Python

Selection in Python. If statements. Control Structures. Sequence Selection Repetition Module. Selection. If or if / else statement choosing between mutually exclusive possibilities Two forms see next slide. Selection. Two forms if logical expression: statement

473 views • 23 slides

Programming in Python

Programming in Python. Michael Schroeder Andreas Henschel {ms, ah}@biotec.tu-dresden.de. Motivation. All these sequences are winged helix DNA binding domains. How can we group them into families?. mkdntvplkliallangefhsgeqlgetlgmsraainkhiqtlrdwgvdvftvpgkgyslpep

1.29k views • 102 slides

Files in Python

Files in Python. The Basics. Why use Files?. Very small amounts of data – just hardcode them into the program A few pieces of data – ask the user to input them More than this, you need an external file stored on secondary storage. External data files. Handles large amounts of data

446 views • 6 slides

Strings in Python

Strings in Python. Computer Science 18 Feb 2011. Introduction. Prior experience Defining string variables Getting user input Printing strings Lesson Objectives Understand string structure Access characters and sub-sections from a string Concatenate strings Traverse a string.

450 views • 15 slides

Files in Python

Files in Python. Buffers. Why a buffer?. Computer equipment runs at different speeds, the hard drive and secondary storage in general is MUCH slower than RAM and the CPU, for example

215 views • 12 slides

Exception Handling In Python | Exceptions In Python | Python Programming Tutorial | Edureka

** Python Certification Training: https://www.edureka.co/python-programming-certification-training **r This Edureka PPT on Exception Handling Tutorial covers all the important aspects of making use and working with Exceptions using Python. It establishes all of the concepts like explaining why we need exception handling, the process of exception handling and how to go about using it practically. r r Agendar Why need Exception Handling?r What is Exception Handling?r Process of Exception Handlingr Coding with Pythonr Try and Except block in Pythonr The else clauser The finally clauser Summaryr r Python Tutorial Playlist: https://goo.gl/WsBpKer Blog Series: http://bit.ly/2sqmP4sr r Instagram: https://www.instagram.com/edureka_lea...r Facebook: https://www.facebook.com/edurekaIN/ r Twitter: https://twitter.com/edurekain r LinkedIn: https://www.linkedin.com/company/edureka

2.85k views • 35 slides

Scheme in Python

Scheme in Python. Overview. We’ll look at how to implement a simple scheme interpreter in Python This is based on the Scheme in Scheme interpreter we studied before We’ll look at pyscheme 1.6, which was implemented by Danny Yoo as an undergraduate at Berkeley

528 views • 48 slides

Iterator in Python

Here, this blog will cover the developers and coders most favorite subject i.e. In the Python Iterators. We're going to do an in-depth analysis of the iterators and how they work in a computer program for Python. For further info visit here https://www.phptpoint.com/python-tutorial/

91 views • 5 slides

Python Training | Python Classes in Pune

Python is a high-level programming language that is used in a wide variety of application domains. Here are the top 6 reasons to learn python programming such as easy to learn, popular frameworks used, computer graphics, handling huge data, data science, and highest salaries in the industry.

116 views • 2 slides

Python in Healthcare

19 views • 6 slides

PYTHON- THE PERFECT CHOICE IN HEALTHCARE TECHNOLOGY-01

Python is by far ranked as the top-notch programming language in the world by the prestigious TIOBE Index as of April 2024. This reflects upon the massive adoption and application rate this clever programming language is been experiencing so far. There is more than one reason that can be quoted for this insane popularity. https://www.usdsi.org/data-science-insights/python-the-perfect-choice-in-healthcare-technology-infographic

20 views • 1 slides

More Related