'Gene symbol' diaporamas de présentation

Bioinformatics I

Bioinformatics I. Date: October 4, 2014. To have an understanding of: Sequence analysis Genome assembly and annotation Publicly available molecular biology and genetic databases Identification of sequence similarity Defining function of biological sequences

549 views • 44 slides

Literature Based Discovery

552 views • 41 slides

BioQA - A question answering system for the biomedical domain

BioQA - A question answering system for the biomedical domain. Luis Tari. Question Answering (QA). What is QA?

487 views • 34 slides

Carnegie Institution for Science, Department of Plant Biology

Carnegie Institution for Science, Department of Plant Biology. Putting TAIR to work for you: Tips and Techniques for Accessing Arabidopsis Data for Plant Biology Research. Kate Dreher TAIR, AraCyc, PMN Carnegie Institution for Science. Overview. Part I: Presentation (with exercises)

526 views • 31 slides

????????????????????????

Tumor-associated gene ( TAG ): a specialized database for cancer research. ????????????????????????. Carcinogenesis. Initiation. Promotion. Progression. Normal cell. Initiated cell. Focal Lesion. Cancer. Oncogene. A proto-oncogene can be activated by.

468 views • 28 slides

A System for Finding Biological Entities that Satisfy Certain Conditions from Texts

A System for Finding Biological Entities that Satisfy Certain Conditions from Texts. Wei Zhou, Clement Yu University of Illinois at Chicago Weiyi, Meng SUNY at Binghamton. Outline. Problem statement Techniques and methods Experimental results Discussion and conclusion. Problem statement.

358 views • 27 slides

Premature human aging: t he progerias

529 views • 22 slides

?????????? 2008/04/09 - FastSNP

362 views • 21 slides

UIC at TREC 2006: Genomics Track

UIC at TREC 2006: Genomics Track. Wei Zhou, Clement T. Yu University of Illinois at Chicago Nov. 16, 2006. 3 stages. Stage 1: Conversion - Greek letters ? English words Stage 2: Paragraph retrieval - retrieve 2,000 most relevant paragraphs Stage 3: Passage extraction and ranking

292 views • 19 slides

Gene Ontology Consortium And GO Database

Gene Ontology Consortium And GO Database. Gene Ontology: tool for the unification of biology

506 views • 15 slides

S earch

283 views • 10 slides

Introduction to databases - Practical

Introduction to databases - Practical. Query Sequence. >my weird new protein MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLYVTVQHKKLRT PLNYILLNLAVADLFMVLGGFTSTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVC KPMSNFRFGENHAIMGVAFTWVMALACAAPPLAGWSRYIPEGLQCSCGIDYYTLKPEVNNESFVIYMFVV

151 views • 6 slides