'Sequence id' diaporamas de présentation

Project: IEEE P802.15 Working Group for Wireless Personal Area Networks (WPANs)

Project: IEEE P802.15 Working Group for Wireless Personal Area Networks (WPANs) Submission Title :[Updated on MPDU Fragmentation Proposal for TG4k] Date Submitted: [Sept 16, 2011] Source :[Benjamin Rolfe] Company [Blind Creek Associates] Address []

407 views • 36 slides

ESTMD System -- A Web-based EST Model Database System

ESTMD System -- A Web-based EST Model Database System. Yinghua Dong. Outline. Project Overview Requirements Cost Estimation Project Plan Potential Risks Demonstration References Acknowledgments. Project Overview -- Objective.

259 views • 25 slides

File storage is a lot like a basement closet...

180 views • 9 slides

Input: AA sequence, sequence ID, Gene Ontology ID, keyword

120 views • 3 slides

N-acetylmuramoyl-L-alanine amidase [Clostridium perfringens ATCC 13124]

Supplementary Fig. 1. Amino acid sequence and predicted domains of the expressed protein. N-acetylmuramoyl-L-alanine amidase [Clostridium perfringens ATCC 13124] Sequence ID: ref|YP_696189.1| Length: 337 1 MKIAVRGGHNFKAKGALGIIDETIENRKVYKALIKYLNIAGHNVIDVTPGECDINTDLYL 60

133 views • 1 slides