'Trp operon' diaporamas de présentation

BIOTECHNOLOGY UNIT:

1.73k views • 138 slides

Control of gene expression

979 views • 74 slides

682 views • 48 slides

CHAPTER 18

CHAPTER 18. REGULATION OF GENE EXPRESSION. I. Overview. Prokaryotes and eukaryotes alter gene expression in response to their changing environment In multicellular eukaryotes, gene expression regulates development and is responsible for differences in cell types

636 views • 46 slides

Transcriptional Control ?? Prokaryote

Transcriptional Control ?? Prokaryote. Transcriptional Control in Prokaryotic Cell. 1. Binding ??? RNA Polymerase ??? Promoter RNA polymerase ???? Holoenzyme ?????? promoter ?????????????? ??????????? enzyme ?????? ??? 2. Operon

680 views • 41 slides

L1 The lac operon

Section L Regulation of Transcription in Prokaryotes L1 The lac operon L2 The trp operon L3 Transcriptional regulation by alternative s factor. L1 The lac operon. The operon The lactose operon The lac repressor Induction cAMP receptor protein.

1.02k views • 29 slides

The tryptophan operon

Presented by: Chandana kalita MSc Biotechnology 2 nd sem Roll no. 03 Gauhati University. The tryptophan operon. Operon in gene regulation in prokaryotes. Gene regulation: The synthesis of particular gene product is controlled by mechanisms collectively called gene regulation

553 views • 29 slides

Annotating a Gene Do I Have the Whole Gene?

Annotating a Gene Do I Have the Whole Gene?. Planctomyces limnophilus imidazole glycerol phosphate synthase subunit hisF VKGVNFLNLQDAGDPVEVAARYERDGADELVFLDITASHEERGIIHDVVR RTSEVCFMPLTVGGGIRNLDDIRTLLQAGCDKVSINSAAVKDPEFVRAAA LKFGKQCIVVNIDPRRVTQPDGSVKWEVHINGGRKPTGLEAVSWAKEVER

355 views • 27 slides

Bacteriophages have tails Animal viruses have an envelope around the capsid

602 views • 26 slides

Regulation and Control of Metabolism in Bacteria

Regulation and Control of Metabolism in Bacteria. Yunika S 10406024. Bacterial Adaptation to the Nutritional and Physical Environment.

465 views • 24 slides

Chapter 13

Chapter 13. Regulatory RNA. 13.1 Introduction. RNA functions as a regulator by forming a region of secondary structure (either inter- or intramolecular) that changes the properties of a target sequence. Figure 13.1: Regulator RNA binds RNA target.

360 views • 24 slides

599 views • 24 slides

L1 The lac operon L2 The trp operon L3 Transcriptional regulation by

Section L: Regulation of transcription in prokaryotes. L1 The lac operon L2 The trp operon L3 Transcriptional regulation by alternative ? factors. L1:The LAC Operon. Operon - what is it? The operon is a unit of gene expression and regulation

581 views • 23 slides

L1 The lac operon L2 The trp operon L3 Transcriptional regulation by

Section L:Regulation of transcription in prokaryotes. Molecular Biology. L1 The lac operon L2 The trp operon L3 Transcriptional regulation by alternative ? factors. Molecular Biology. L1:The LAC Operon. Operon - what is it?

352 views • 23 slides

Operons fancy light switches

Operons fancy light switches. Ch 18. We all seek control. Think of a light switch Two purposes, on and off Sometimes we need light Advantages: have it when needed, i.e. the expression of what we want We can use this built in convenience mechanism to use things when necessary

235 views • 14 slides

Protein Synthesis

Protein Synthesis. Control Mechanisms. Control Mechansisms. the human genome contains about 20000-25000 genes that code for proteins housekeeping genes code for proteins that are always needed in a cell; they are constantly being transcribed and translated

192 views • 14 slides

Genetics - Ch 10

Genetics - Ch 10. Molecular Mechanisms of Gene Regulation. Control of Gene Expression. DNA -------------> RNA ------------> protein. transcriptional control. translational control.

270 views • 14 slides

Chapter 19 ~ Microbial Models: The Genetics of Viruses and Bacteria

299 views • 13 slides

Control Mechanisms for Gene Expression

208 views • 11 slides

Operons

206 views • 4 slides