Download
makalah n.
Skip this Video
Loading SlideShow in 5 Seconds..
MAKALAH PowerPoint Presentation

MAKALAH

456 Views Download Presentation
Download Presentation

MAKALAH

- - - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript

  1. MAKALAH JARINGAN KOMPUTER

  2. JARINGAN INTERNET NAMA : MAYANG SARINPM : 201243501154 PROGRAM STUDI TEKNIK INFORMATIKA FAKULTAS TEKNIK MATEMATIKA DAN ILMU PENGETAHUAN ALAM UNIVERSITAS INDRAPRASTA PGRI 2013

  3. A. Pengertian Jaringan Internet. • Internet adalah jaringan komputer yang bisa dikategorikan sebagai WAN, menghubungkan berjuta komputer diseluruh dunia, tanpa batas negara, dimana setiap orang yang memiliki komputer dapat bergabung ke dalam jaringan ini hanya dengan melakukan koneksi ke penyedia layanan internet (internet service provider / ISP) seperti Telkom Speedy, atau IndosatNet.

  4. A. Pengertian Jaringan Internet. • Protokol koneksi yang digunakan adalah SLIP (Serial Line Interface Protocol) atau PPP (Point-to-Point Protocol), dimana koneksi SLIP biasanya lebih lambat dari PPP. • GAMBAR: Koneksi ke Internet • Secara logis jaringan internet dibagi kedalam beberapa domain, yang menurut standar IPv4 (Internet Protocol version 4) di-identifikasi melalui nomer IP 32 bit atau 4 angka biner yang dipisahkan dengan titik (seperti 192.168.10.25).

  5. Sejarah dan Fungsi Jaringan Internet • Sejarah Internet • Pada tahun 1969 Departemen Pertahanan Amerika Serikat dalam proyek ARPA - ARPANET (Advanced Research Project Agency Network) melakukan demontrasi bagaimana bisa melakukan komunikasi tanpa batasan jarak (jarak tak terhingga) melalui saluran telepon menggunakan hardware dan software komputer berbasis Sistem Operasi UNIX. Pada proyerk ARPANET tersebut setelah dirancang bentuk jaringan dengan standarisasi kehandalan dan seberapa besar informasi dapat dipindahkan untuk saling berbagi maka terbentuklah sebuah protokol baru yang dikenal TCP/IP (Transmission Control Protocol/Internet Protocol).

  6. Sejarah dan Fungsi Jaringan Internet SEJARAH • ARPANET pada tahun 1969 awalnya hanya menghubungkan 4 situs saja diantaranya yaitu Stanford Research Institute, University of California, Santa Barbara, University of Utah menjadi jaringan secara terpadu. Lalu pada bulan Oktober 1972 ARPANET diperkenalkan secara umum dan tidak lama kemudian berkembang sangat pesat di seluruh wilayah sampai ARPANET kesulitan dalam mengaturnya. Maka ARPANET di pecah menjadi dua bagian yaitu "MILNET" untuk keperluan militer dan ARPANET yang lebih kecil dalam keperluan non-militer. Seiring waktu gabungan antara kedua jaringan tersebut dikenal masyarakat luas dengan nama DARPA Internet dan kemudian disederhanakan lagi menjadi Internet yang seperti sekarang ini kita kenal.

  7. Sejarah dan Fungsi Jaringan Internet Fungsi internet • secara sederhana yaitu sebagai media komunikasi, akses informasi, berbagi sumber daya atau data, dalam hal ini berarti dengan internet bisa menyiarkan dan mengakses secara langsung baik berita informasi dan bertukar data dengan akses internet online ke seluruh penjuru dunia tanpa ada batasan wilayah geografis dari setiap penggunanya. Internet bisa diibaratkan seperti komputer yang saling berbicara satu sama lain dan juga bisa bertukar data secara langsung setelah komputer terhubung pada jaringan internet menggunakan TCP/IP.

  8. Sejarah dan Fungsi Jaringan Internet • fungsi internet baik untuk membantu dalam berbagai persoalan hidup dengan mendapatkan pemecahannya diberbagai situs, membantu pekerjaan dan bahkan internet itu sendiri dijadikan lahan pekerjaan oleh sebagian orang, membantu tugas sekolah dan juga sarana hiburan yang lengkap sekali disajikan di dunia online dengan terhubung ke internet. • Internet mencangkup segala sesuatu secara luas baik itu dalam bidang komputerisasi maupun telekomunikasi. Kegunaan internet • Dari waktu ke waktu semakin dibutuhkan oleh berbagai element masyarakat maupun badan usaha untuk berbagai kebutuhan yang disesuaikan, baik untuk meningkatkan produktivitas ataupun sarana bertukar data dan juga akses informasi maupun sarana hiburan online yang sangat lengkap.

  9. Jenis-jenisjaringan internet • LAN ( Local Area Network )Local Area Network (LAN) merupakan jaringan milik pribadi di dalam sebuah gedung atau kampus yang berukuran sampai beberapa kilometer.LAN seringkali digunakan untuk menghubungkan komputer-komputer pribadi dan workstation dalam kantor perusahaan atau pabrik-pabrik untuk memakai bersama resource (misalnya, printer, scanner) dan saling bertukar informasi. LAN dapat dibedakan dari jenis jaringan lainnya berdasarkan tiga karakteristik: ukuran, teknologi transmisi dan topologinya. LAN

  10. Jenis-jenisjarianganinternet • LAN mempunyai ukuran yang terbatas, yang berarti bahwa waktu transmisi pada keadaan terburuknya terbatas dan dapat diketahui sebelumnya. Dengan mengetahui keterbatasnnya, menyebabkan adanya kemungkinan untuk menggunakan jenis desain tertentu. Hal ini juga memudahkan manajemen jaringan.LAN seringkali menggunakan teknologih transmisi kabel tunggal. LAN tradisional beroperasi pada kecepatan mulai 10 sampai 100 Mbps (mega bit/detik) dengan delay rendah (puluhan mikro second) dan mempunyai faktor kesalahan yang kecil. LAN-LAN modern dapat beroperasi pada kecepatan yang lebih tinggi, sampai ratusan megabit/detik. LAN

  11. Jenis-jenisjariangan internet • MAN ( Metropolitan Area Network )Metropolitan Area Network (MAN) padadasarnyamerupakanversi LAN yang berukuranlebihbesardanbiasanyamemakaiteknologi yang samadengan LAN. MAN dapatmencakupkantor-kantorperusahaan yang berdekatandandapatdimanfaatkanuntukkeperluanpribadi (swasta) atauumum. MAN biasanyamamapumenunjang data dansuara, danbahkandapatberhubungandenganjaringantelevisikabel. MAN hanyamemilikisebuahatauduabuiahkabeldantidakmempunyaielemen switching, yang berfungsiuntukmengaturpaketmelaluibeberapa output kabel. Adanyaelemen switching membuatrancanganmenjadilebihsederhana. MAN

  12. Jenis-jenisjariangan internet • Alasanutamamemisahkan MAN sebagaikategorikhususadalahtelahditentukannyastandartuntuk MAN, danstandartinisekarangsedangdiimplementasikan. Standarttersebutdisebut DQDB (Distributed Queue Dual Bus) atau 802.6 menurutstandart IEEE. DQDB terdiridariduabuahkabel unidirectional dimanasemuakomputerdihubungkan, sepertiditunjukkanpadagambar 1.2. Setiap bus mempunyaisebuah head–end, perangkatuntukmemulaiaktivitastransmisi. Lalulintas yang menujukomputer yang berada di sebelahkananpengirimmenggunakan bus bagianatas. Lalulintaskearahkirimenggunakan bus yang berada di bawah MAN

  13. Jenis-jenisjariangan internet • WAN ( Wide Area Network )Wide Area Network (WAN) mencakupdaerahgeografis yang luas, sertingkalimencakupsebuahnegaraataubenua. WAN terdiridarikumpulanmesin yang bertujuanuntukmejalankan program-program aplikasi.Kita akanmengikutipenggunaantradisionaldanmenyebutmesin-mesininisebagai host. Istilah End System kadang-kadangjugadigunakandalamliteratur. Host dihubungkandengansebuah subnet komunikasi, ataucukupdisebut subnet. Tugas subnet adalahmembawapesandari host ke host lainnya, sepertihalnyasistemtelepon yang membawaisipembicaraandaripembicarakependengar. Denganmemisahkanaspekkomunikasimurnisebuahjaringan (subnet) dariaspek-aspekaplikasi (host), rancanganjaringanlengkapmenjadijauhlebihsederhana. WAN

  14. Jenis-jenisjariangan internet • Pada sebagian besar WAN, subnet terdiri dari dua komponen, yaitu kabel transmisi dan elemen switching. Kabel transmisi (disebut juga sirkuit, channel, atau trunk) memindahkan bit-bit dari satu mesin ke mesin lainnya.Element switching adalah komputer khusus yang dipakai untuk menghubungkan dua kabel transmisi atau lebih. Saat data sampai ke kabel penerima, element switching harus memilih kabel pengirim untuk meneruskan pesan-pesan tersebut. Sayangnya tidak ada terminologi standart dalam menamakan komputer seperti ini. Namanya sangat bervariasi disebut paket switching node, intermidiate system, data switching exchange dan sebagainya. WAN

  15. Jenis-jenisjariangan internet • Jaringan Tanpa KabelKomputer mobile seperti komputer notebook dan personal digital assistant (PDA), merupakan cabang industri komputer yang paling cepat pertumbuhannya. Banyak pemilik jenis komputer tersebut yang sebenarnya telah memiliki mesin-mesin desktop yang terpasang pada LAN atau WAN tetapi karena koneksi kabel tidaklah mungkin dibuat di dalam mobil atau pesawat terbang, maka banyak yang tertarik untuk memiliki komputer dengan jaringan tanpa kabel ini.Jaringan tanpa kabel mempunyai berbagai manfaat, yang telah umum dikenal adalah kantor portable. Orang yang sedang dalam perjalanan seringkali ingin menggunakan peralatan elektronik portable-nya untuk mengirim atau menerima telepon, fax, e-mail, membaca fail jarak jauh login ke mesin jarak jauh, dan sebagainya dan juga ingin melakukan hal-hal tersebut dimana saja, darat, laut, udara.

  16. Jenis-jenisjariangan internet • InternetSebenarnya terdapat banyak jaringan didunia ini, seringkali menggunakan perangkat keras dan perangkat lunak yang berbeda-beda. Orang yang terhubung ke jaringan sering berharap untuk bisa berkomunikasi dengan orang lain yang terhubung ke jaringan lainnya. Keinginan seperti ini memerlukan hubungan antar jaringan yang seringkali tidak kampatibel dan berbeda. Biasanya untuk melakukan hal ini diperlukan sebuah mesin yang disebut gateway guna melakukan hubungan dan melaksanakan terjemahan yang diperlukan, baik perangkat keras maupun perangkat lunaknya. Kumpulan jaringan yang terinterkoneksi inilah yang disebut dengan internet.

  17. B. SejarahPerkembangan Internet TeknologiInformasidan Telekomunikasi (Information and Communication Technology/ICT) merupakantulangpunggungaplikasi Web 2.0. PerkembanganTeknologiInformasidanKomunikasi yang fenomenaldanmenjadiawalmunculnyaaplikasi web adalah Internet. Internet yang berawaldaririsetuntukpertahanandankeamanansertapendidikanberkembangmenjadiperangkatpendukungbisnis yang sangatberpengaruh. Dalamkaitandenganaplikasi Web 2.0 ini, terdapatbeberapaperistiwapentingdalamsejarah internet.

  18. B. SejarahPerkembangan Internet Perkembangan Internet Di Indonesia Saatini • Di era perinternetansaatinimakadibutuhkansebuah website dalammenunjangbisnisduniamayaini. Kita tahubahwadenganadanya internet makasemuanyaterasatidakterbatasantararuangdanwaktu. Semuadimensiterlampauioleh media yang namanya website dan internet. • Perkembanganduniamaya di indonesiainimemangcukupmembanggakan, apalagidengandukunganpemerintah yang sangatkooperatif. Pemerintah pun melakukanlangkahnyatadalammengembangkan internet di Indonesia. Lihatsajasekarangbanyakdesa-desa yang sudahterjangkau internet untuksaatini, memangtidaksemuadesaterjangkau internet semua. Namunlambatlaunpastiakanterwujudnegara Indonesia yang berkembangdenganinternetnya. Bolehdikatakansekarang Internet masukdesa, ibaratdahululistrikmasukdesa. • Melihatperkembangantersebutdengandidukungnyaolehpemerintahmakasudahsepatutnya media internet dikedepan. Prospek internet yang begitubaikmembuatpelaku-pelakubisnis internet pun bekermbangpesat. Banyakpelakubisnisbaru yang bermunculandanpelakubisnis yang lama semakinberkembang.

  19. B. SejarahPerkembangan Internet Beberapa Penemuan Perkembangan Jaringan Internet Terbesar A. Perkembangan besar Internet pertama adalah penemuan terpenting ARPA yaitu packet switching pada tahun 1960. •  Packet switching adalah pengiriman pesan yang dapat dipecah dalam paket-paket kecil yang masing-masing paketnya dapat melalui berbagai alternatif jalur jika salahsatu jalur rusak untuk mencapai tujuan yang telah ditentukan. Packet switching juga memungkinkan jaringan dapat digunakan secara bersamaan untuk melakukan banyak koneksi, berbeda dengan jalur telepon yang memerlukan jalur khusus untuk melakukan koneksi. Maka ketika ARPANET menjadi jaringan komputer nasional di Amerika Serikat pada 1969, packet switching digunakan secara menyeluruh sebagai metode komunikasinya menggantikan circuit switching yang digunakan pada sambungan telepon publik.

  20. B. SejarahPerkembangan Internet B. Perkembangan besar Internet kedua yang dicatat pada sejarah internet adalah pengembangan lapisan protokol jaringan yang terkenal karena paling banyak digunakan sekarang yaitu TCP/IP (Transmission Control Protocol/ Internet Protocol).  • Protokol adalah suatu kumpulan aturan untuk berhubungan antarjaringan. Protokol ini dikembangkan oleh Robert Kahn dan Vinton Cerf pada tahun 1974. Dengan protokol yang standar dan disepakati secara luas, maka jaringan lokal yang tersebar di berbagai tempat dapat saling terhubung membentuk jaringan raksasa bahkan sekarang ini menjangkau seluruh dunia. Jaringan dengan menggunakan protokol internet inilah yang sering disebut sebagai jaringan internet. Jaringan ARPANET menjadi semakin besar sejak saat itu dan mulai dikelola oleh pihak swasta pada tahun 1984, maka semakin banyak universitas tergabung dan mulailah perusahaan komersial masuk. Protokol TCP/IP menjadi protokol umum yang disepakati sehingga dapat saling berkomunikasi pada jaringan internet ini.

  21. B. SejarahPerkembangan Internet C. Perkembangan besar Internet ketiga adalah terbangunnya aplikasi World Wide Web pada tahun 1990 oleh Tim Berners-Lee. • Aplikasi World Wide Web (WWW) ini menjadi konten yang dinanti semua pengguna internet. WWW membuat semua pengguna dapat saling berbagi bermacam-macam aplikasi dan konten, serta saling mengaitkan materi-materi yang tersebar di internet. Sejak saat itu pertumbuhan pengguna internet meroket.Disukaiatautidak, dampakdari era reformasi 1998 benar-benarmembawadampak yang signifikandalamperkembanganduniatelekomunikasi, informatikadanintenet. Tiranidanmonopolidarirezimterdahuluseakanbenar-benartersingkirkanakibatadanyareformasitersebut.

  22. B. SejarahPerkembangan Internet • Perkembangan Media Internet saatini1. Media AksesDial up, memang media inimasihadadanmasihbisadigunakansaatini, bahkanparapenyediajasa internet masihtetapmenjuallayanantersebut. Namunperlahannamunpasti media-media akseslainnya yang menjanjikankualitasdanharga yang kompetitifmembuat dial-up mungkinmenjadipilihanterakhirjikakitaakanmelakukankoneksike Internet.

  23. B. SejarahPerkembangan Internet • Layanan hotspot wi-figratisan/berbayarjugatetapdipiliholehparapelanggankarenadiyakinimemberikankualitas yang mencukupi. Di beberapawilayahperumahan di Jakarta, koneksi internet yang disediakanolehsalahsatupenyedialayanan TV kabel pun menjadipilihanuntukkoneksike Internet.Begitupunteknologi ADSL yang diusungolehsalahsatupenyediajasatelekomunikasi incumbent. Namunkarenaketerbatasaninfrastruktur yang merekamilikimakakembalilayanan internet dari operator selularmenjadibanyakdipiliholehkalangan yang inginterkoneksike Internet di rumah-rumah.MEDIA AKSES

  24. B. SejarahPerkembangan Internet • 2. KontenTersedianyaberagamkontensaatinimembuatmasyarakatsemakinnyamanuntukmelakukanberbagaiaktivitas di Internet. Forum, layanan e-mail, berbagaimacam portal sudahtersediasaatini, baikprodukdalamnegeriataupunprodukdarinegeritetangga. Bahkansalahsatu trend saatiniyaitu Blog mendapat response yang sangatbagus di masyarakat Indonesia. Dan denganeksistensiini Indonesia cukupdiperhitungkan di dunia blog international.

  25. B. SejarahPerkembangan Internet • 3. Social NetworkingSampaisaatini Yahoo Messenger masihmerupakan media chating yang paling diminati. Facebook merupakansalahsatufenomena social networking yang diminatiolehberbagailapisanmasyarakat. Pelajar, mahasiswa, ibu-iburumahtangga, kalangan professional hinggaartisdankalanganpolitiksekalipunbanyak yang menggunakan Facebook untukdapatterussalingberhubungandengan yang lain.Twitter, Plurkmenjadipelengkapdunia social networking saatini. Namun, dimanakahkontenlokalproduksianaknegeri? Tidakperlukhawatir, Kaskus, Fupei, Koprolmerupakanprodukdalamnegeri yang cukupdiminatidansukses.

  26. B. SejarahPerkembangan Internet • 4. Terminal OSKetikaharga laptop mulaiturundansemakinterjangkau, lalumuncullahsatu trend barudalamkehidupanmasyarakatdimanakafe-kafedantempatumummenyediakan hotspot wi-fibagiparapengunjungnya. Sungguhsangatbiasamelihatpengunjungkafeasikbecengkramadenganlaptopnya.Namunternyatatrentersebutjugatidakbertahan lama, laptop masihterlalubesaruntukdibawakemana-mana, walaupunsaatini netbook (laptop yang lebihkecilukurannya) jugatersediadenganharga yang lebihterjangkau. Dan akhirnyamerekalebihmemilih terminal yang lebihkecildanbisadibawakemanapuntanpamembuatmerekaribet.Smartphone, itulahjawabannya. Ketika Nokia memutuskanmemilih Indonesia sebagaitempatpeluncuranpertama di duniauntuk product Communicator-nya, itumerupakantonggakawal yang menunjukanbahwa 'mobile internet' merupakantren yang akanterusberkembangpesatbukanhanya di Indonesia, namun di belahandunialainnya, danhaltersebutterbuktisaatini.

  27. Dampak positif, Dan Negatif Internet • DampakPositif :1. Internet sebagai media komunikasi, merupakanfungsi internet yang paling banyakdigunakandimanasetiappengguna internet dapatberkomunikasidenganpenggunalainnyadariseluruhdunia.2. Media pertukaran data, denganmenggunakan email, newsgroup, ftp dan www (world wide web) parapengguna internet di seluruhduniadapatsalingbertukarinformasidengancepatdanmurah.3. Media untukmencariinformasiatau data, perkembangan internet yang pesat, menjadikan www sebagaisalahsatusumberinformasi yang pentingdanakurat.4. Kemudahanmemperolehinformasi yang ada di internet sehinggamanusiatahuapasaja yang terjadi.5. Bisadigunakansebagailahaninformasiuntukbidangpendidikan, kebudayaan, dan lain-lain6. Kemudahanbertransaksidanberbisnisdalambidangperdagangansehinggatidakperlupergimenujuketempatpenawaran/penjualan.

  28. Dampak positif, Dan Negatif Internet • DampakNegatif :PornografiAnggapan yang mengatakanbahwa internet identikdenganpornografi, memangtidaksalah. Dengankemampuanpenyampaianinformasi yang dimiliki internet, pornografi pun merajalela. Untukmengantisipasihalini, paraprodusen ‘browser’ melengkapi program merekadengankemampuanuntukmemilihjenis home-page yang dapat di-akses. Di internet terdapatgambar-gambarpornografidankekerasan yang bisamengakibatkandorongankepadaseseoranguntukbertindakkriminal. • Violence and GoreKekejamandankesadisanjugabanyakditampilkan. Karenasegibisnisdanisipadadunia internet tidakterbatas, makaparapemiliksitusmenggunakansegalamacamcara agar dapatmenjualsitusmereka. Salah satunyadenganmenampilkanhal-hal yang bersifattabu.PenipuanHal inimemangmerajalela di bidangmanapun. Internet pun tidakluputdariseranganpenipu. Cara yang terbaikadalahtidakmengindahkanhaliniataumengkonfirmasiinformasi yang Andadapatkanpadapenyediainformasitersebut.

  29. Dampak positif, Dan Negatif Internet • CardingKarenasifatnya yang langsung, carabelanjadenganmenggunakanKartukreditadalahcarayang paling banyakdigunakandalamdunia internet. Para penjahat internet pun paling banyakmelakukankejahatandalambidangini. Dengansifat yang terbuka, parapenjahatmampumendeteksiadanyatransaksi (yang menggunakanKartuKredit) on-line danmencatatkodeKartu yang digunakan. Untukselanjutnyamerekamenggunakan data yang merekadapatkanuntukkepentingankejahatanmereka.PerjudianDampaklainnyaadalahmeluasnyaperjudian. Denganjaringan yang tersedia, parapenjuditidakperlupergiketempatkhususuntukmemenuhikeinginannya. Andahanyaperlumenghindarisitussepertiini, karenaumumnyasitusperjudiantidakagresifdanmemerlukanbanyakpersetujuandaripengunjungnya.1. Mengurangisifatsosialmanusiakarenacenderunglebihsukaberhubunganlewatinternet daripadabertemusecaralangsung (face to face).2. Dari sifatsosial yang berubahdapatmengakibatkanperubahanpolamasyarakatdalamberinteraksi.3.Kejahatansepertimenipudanmencuridapatdilakukan di internet (kejahatanjugaikutberkembang).4. Bisamembuatseseorangkecanduan, terutama yang menyangkutpornografidandapatmenghabiskanuangkarenahanyauntukmelayanikecanduantersebut.

  30. C. Jaringan Proxy dalam internet Proxy server adalah program yang menerimapermintaan (request)dariklien, seperti browser web atau ftp klien,dankemudianmeneruskanpermintaantersebutke server internet yang dituju. Salah satu program yang cukuppowerfulldalammenanganimasalahketerbatasankecepatanaksesdankeamanan data yang dipergunakanuntukmenanganikeperluan internet adalah SQUID. Bagiseseorang administrator jaringan,merupakantugasutamauntukmengaturlau-lintas data dalamsuatujaringanbaikdaridalammaupunkeluarjaringan

  31. C. Jaringan Proxy dalam internet • Kelebihanmenggunakan Proxy server Kelebihan Operating System yang menggunakan proxy adalah data yang diminta dari klien akan diarahkan ke server proxy kemudian dilanjutkan ke server internet.Pada saat data dari server datang,data tersebut akan diarahkan oleh server internet ke server proxy kemudian server proxy meneruskan data tsb ke klien yg memintanya. Disamping memberikan data ke klien,server proxy juga menyimpansalinan data itu sebagaiwebcachedihardisk.Apabila ada user lain yg meminta data yg sama,maka server proxy akan mengambil data tersebut dari hardisknya tanpa harus melakukan koneksi ke server internetyg menyediakan data tsb. Kalau permintaan yg sama dilakukan oleh user berkali-kali tentu akan mempengaruhi kecepatan akses internet secara signifikan.

  32. C. Jaringan Proxy dalam internet • fungsi proxy sebagai caching denganmenyimpanhalamantersebutpada server lokal, proxy dapatmenghilangkanakses Internet yang berlebihuntukmengambilkembalihalaman yang samaberulang-ulang. Jadi, proxy mula-mulasangatefektifuntuk web caching. Namun, Internet sekarangsudahcepat, halaman web bersifatdinamisdankepentingan user di dalamsatuorganisasihanyaterdiridariratusanhalaman web. Faktor-faktorinimenyebabkan caching proxy menjaditidakefektif, kecualipadaorganisasi yang sangatbesaratau ISP. Meskipunsemua browser standarmempunyaidukunganterhadap proxy server, sejak 1996 jarangdigunakan.

  33. C. Jaringan Proxy dalam internet • Cara Kerja Proxy Proxy bekerjadenganmendengarkan request dari client internal danmengirim request tersebutkejaringaneksternalseolah-olah proxy server itusendiri yang menjadi client. Padawaktu proxy server menerimarespondan server publik, iamemberikanrespontersebutke client yang asliseolah-olahia public server. tingkatkeamanan proxy ???? Internet yang sekarangjugamempunyaicirinyasendiri, dan proxy server menunjukkanefeksamping yang sungguhtakterduga: merekadapatmenyembunyikansemua user di belakangsatumesin, merekadapatmemfilter URL, danmerekadapatmembuang content yang mencurigakanatauilegal. Jadimeskipunmula-muladibuatsebagai cache nonsekuriti, tujuanutama proxy server sekarangmenjadi firewalling.

  34. C. Jaringan Proxy dalam internet • Proxy TidakMelindungiJaringan local Proxy server berdasarkanpada web server danseperti web server, merekaberoperasipada Application Layer—di atas Network dan Transport Layer. Iniberartimerekatidakmelakukanapa-apaselainmemfilterpaket TCP/IP yang tiba di server, danmerekatidakmencampurilayanan Application Layer yang lain seperti file sharing atau remote procedure call. Hal ini membuat komputer terbuka terhadap hacking, kecuali jika Anda mengambil langkah lain untuk mengamankan komputer. Walaupun kebanyakan operating system modern mendukung pemilteran paket, tetapi filter mereka tidak sekuat firewall sungguhan. Yang perlu Anda pastikan adalah hanya port publik untuk layanan yang Anda proxy yang dibuka.

  35. C. Jaringan Proxy dalam internet Masalah Proxy TerhadapKinerja Proxy server mempunyaisatukekuranganpadakinerja, • yaitu proxy server membuat bottleneck. Seperti firewall atau router, satukoneksi proxy server ke Internet dapatmembuat bottleneck jikatidak di-upgrade ketikajumlah user jaringanbertambah. Walaupun proxy awalnyameningkatkankinerjamelaluimekanisme caching, Andaakanmembuatsemua orang menunggu di belakangmesin yang lambatjikaAndamendapatkanlebihbanyakkliendari yang dapatdidukungoleh server. Namun, hati-hati dalam menyalahkan proxy Anda jika terjadi bottleneck yang sebenarnya disebabkan oleh jalur Internet yang lambat. Jika Anda hanya mempunyai satu koneksi Internet, dan itu adalah T1 (1,5 MB) atau yang lebih lambat, semua komputer yang betul-betul memenuhi kebutuhan minimum operating system dan proxy server sudah cukup cepat dalam menangani beban yang ada. Bottleneck proxy hanya dapat terjadi bila koneksi jaringan lebih cepat dari 1,5 MB/s atau pada waktu ada yang salah dengan proxy server.

  36. C. Jaringan Proxy dalam internet • Fungsi proxy server di buat untuk kejahatan Para Booter seringkali menyerang atau melumpuhkan koneksi yahoo messenger seseorang tidak hanya melalui satu cara saja semisal PM Bomb. PM Bomb memang merupakan jenis Bot yang paling sering digunakan oleh para Booter terutama yang pemula. PM Bomb jika berhasil atau lawan tidak memiliki pertahanan memang sangat menyebalkan karena tampilan dimonitor yang dipenuhi dengan windows PM Bomb ini. Akan tetapi sebenarnya jenis PM Bomb bukan merupakan jenis bot yang mumpuni atau memiliki efektifitas mendiskonekkan seseorang yang bagus. Memang jika digunakan dengan 1000 ID atau lebih hal tersebut bisa sangat berguna akan tetapi jika hanya puluhan atau ratusan efektifitas untuk penyerangan tidaklah bisa terjamin, terutama jika pihak yang diserang memiliki koneksitas yang besar. Beberapa jenis Bot semisal invite game lebih cepat dan mumpuni menyerang target dibandingakan dengan PM Bomb.

  37. Kesimpulan : • Jaringan internet sangat luas untuk di gunakan, dan banyak manfaat serta fungsi yang bermanfaat bagi perusahaan-perusahaan didunia. Perkembangan Internet telah dan terus berkembang sangat pesat membuat penggunanya semakin bertambah dan terus bertambah dengan berbagai layanan yang bisa didapatkan baik dalam mengakses informasi dari berbagai situs, komunikasi live chat, email gratis, dan berbagi data dengan secara langsung menggunakan software dan tools tertentu atau menggunakan File Transfer Protocol (FTP). • Semuaberubahdengansangatcepatnya, dimanaperubahantersebutharussiapkitaantisipasi agar tidakketinggalangerbongperubahan.Perkembangan internet diduniasangatlahpesat,kadang internet dijadiaknsuatuwadahuntukkejahatan, bahkanperkembangansekarangtidakhanyauntukdijadikanusaha, tapijugauntukrefresing di duniamayabagianakremajabahkankalangan yang sudahberumurjugamasihmenggunakanakses internet untukkepentinganpribad.

  38. Kesimpulan : • Bahkan Jaringan internet banyak mengakses berbagai macam jaringan seperti proxy server. Proxy server (peladen proxy) adalah sebuah komputer server atau program komputer yang dapat bertindak sebagai komputer lainnya untuk melakukan request terhadap content dari Internet atau intranet. • Proxy Server bertindak sebagai gateway terhadap dunia Internet untuk setiap komputer klien. Proxy server tidak terlihat oleh komputer klien: seorang pengguna yang berinteraksi dengan Internet melalui sebuah proxy server tidak akan mengetahui bahwa sebuah proxy server sedang menangani request yang dilakukannya. Web server yang menerima request dari proxy server akan menginterpretasikan request-request tersebut seolah-olah request itu datang secara langsung dari komputer klien, bukan dari proxy server. • Proxy server juga dapat dapt berguna untuk caching selain itu juga  digunakan untuk mengamankan jaringan pribadi yang dihubungkan ke sebuah jaringan publik (seperti halnya Internet). Proxy server memiliki lebih banyak fungsi daripada router yang memiliki fitur packet filtering karena memang proxy server beroperasi pada level yang lebih tinggi dan memiliki kontrol yang lebih menyeluruh terhadap akses jaringan. Proxy server yang berfungsi sebagai sebuah “agen keamanan” untuk sebuah jaringan pribadi, umumnya dikenal sebagai firewall.

  39. SEKIAN TERIMA KASIH