tobit
Uploaded by
52 SLIDES
716 VUES
520LIKES

Protein Analysis Course

DESCRIPTION

Protein Analysis Course. Day 1: Databases, dotplots and pairwise alignment. Todays timetable. Databases and file formats Exercises Dotplot and pairwise alignment Exercises Coffee breaks during the exercises. Databases and file formats. Sequence file format FASTA

1 / 52

Télécharger la présentation

Protein Analysis Course

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. Protein Analysis Course Day 1: Databases, dotplots and pairwise alignment

  2. Todays timetable • Databases and file formats • Exercises • Dotplot and pairwise alignment • Exercises Coffee breaks during the exercises

  3. Databases and file formats • Sequence file format • FASTA • UniProt (Universal protein resource) • Primary structure • PDB (Protein Database) • Tertiary structure

  4. Sequence file format • FASTA (a.k.a Pearson format) • Most commonly used • Can be easily construted by hand if needed • Straightforward way to store multiple sequences – just concatenate multiple FASTA –files • Content: • First line (Header line) always starts with symbol ”>” followed by identifiers and descriptions • Header line is ALWAYS just one line before sequence • After header line (from the second line) starts the sequence (presented using single-letter codes) • Sequence normally divided into multiple lines (often required) • Recommended line length max 80 chars (also with header line)

  5. FASTA >SEQUENCE_1 MTEITAAMVKELRESTGAGMMDCKNALSETNGDFDKAVQLLREKGLGKAAKKADRLAAEG LVSVKVSDDFTIAAMRPSYLSYEDLDMTFVENEYKALVAELEKENEERRRLKDPNKPEHK IPQFASRKQLSDAILKEAEEKIKEELKAQGKPEKIWDNIIPGKMNSFIADNSQLDSKLTL MGQFYVMDDKKTVEQVIAEKEKEFGGKIKIVEFICFEVGEGLEKKTEDFAAEVAAQL >SEQUENCE_2 SATVSEINSETDFVAKNDQFIALTKDTTAHIQSNSLQSVEELHSSTINGVKFEEYLKSQI ATIGENLVVRRFATLKAGANGVVNGYIHTNGRVGVVIAAACDSAEVASKSRDLLRQICMH …

  6. Databases: UniProt • UniProt is the universal protein resource, a central repository of protein data created by combining Swiss-Prot, TrEMBL and PIR. This makes it the world's most comprehensive resource on protein information [wikipedia] • UniProt provides three core database: • The UniProt Archive (UniParc) provides a stable, comprehensive sequence collection without redundant sequences by storing the complete body of publicly available protein sequence data • The UniProt Reference Clusters (UniRef) databases provide non-redundant reference data collections based on the UniProt knowledgebase in order to obtain complete coverage of sequence space at several resolutions • The UniProt Knowledgebase (UniProtKB) is the central database of protein sequences with accurate, consistent, and rich sequence and functional annotation

  7. UniProt Archive (UniParc) • Comprehensive and non-redundant database that contains most of the publicly available protein sequences in the world • Currently UniParc contains protein sequences from the following publicly available databases: • EMBL/DDBJ/GenBank nucleotide sequence databases • Ensembl • European Patent Office (EPO) • FlyBase • H-Invitational Database (H-Inv) • Internation Protein Index (IPI) • Japan Patent Office (JPO) • PIR-PSD • Protein Data Bank (PDB) • Protein Research Foundation (PRF) • RefSeq • Saccharomyces Genome database (SGD) • TAIR Arabidopsis thaliana Information Resource • TROME • USA Patent Office (USPTO) • UniProtKB/Swiss-Prot, UniProtKB/Swiss-Prot protein isoforms, UniProtKB/TrEMBL • Vertebrate Genome Annotation database (VEGA) • WormBase

  8. UniProt Reference Clusters (UniRef) • Sequence clusters, used to speed up similarity searches • UniRef100 • Cluster is composed of sequences that are identical • UniRef90 • Cluster is composed of sequences that have at least 90% sequence identity • UniRef50 • Cluster is composed of sequences that have at least 50% sequence identity

  9. Protein knowledgebase (UniProtKB) • Is the central hub for the collection of functional information on proteins, with accurate, consistent and rich annotation • Consists of two sections: • Swiss-Prot, which is manually annotated and reviewed by curator • TrEMBL, which is automatically annotated and is not reviewed

  10. UniProt entry • Every line in a entry begins with a 2 letter identifier • UniProt format closely resembles EMBL format except that considerably more information about physical and biochemical properties is provided • More information here

  11. Databases: PDB • Founded in 1971 by Brookhaven National Laboratory, New York. • Transferred to the Research Collaboratory for Structural Bioinformatics (RCSB) in 1998. • Currently it holds more than 55,000 released structures.

  12. PDB • Methods used to solve 3d structure: • X-ray: 86% • NMR: 13% • Electron Microscopy: 0,7% • Other: 0,3%

  13. PDB file format • Text file – you can edit with a text editor e.g. WordPad • Atomic co-ordinates • Rich annotation • Citation • Experimental Method • Biological source e. • Etc.

  14. FYI: Errors in databases • Be aware of errors in the databases: • sequence errors: • genome projects’ error rate is 1/10,000nts; • ESTs’ error rate is 1/100nts. • annotation errors: • Automated computer programs do not always give correct annotations. • SwissProt is a protein database curated and annotated manually by biologists. Most reliable database, but is not up-to-date

  15. Exercises • Go to the course web page and start with exercises given in file: database_exercises.doc • http://ekhidna.biocenter.helsinki.fi/how

  16. Pairwise sequence alignments • Motivation – Why alignments? • Sequence comparison • Dotplot • The alignment problem • Pairwise alignment algorithms • Exact algorithms • Heuristic algorithms • Database searches • Web tools: • Build alignments using EBI server, • Blast at NCBI, EBI, • PairsDB, …

  17. Motivation • Proteins perform most of the functions required in biological systems: • Signaling (kinases, ...) • Enzymes (proteases, …) • Structural (collagen, elastin, …) • Immune system (antibodies, ...) • Storage and transport (hemoglobin, …) • … • Large amount of information available in current databanks. • Goal: Want to extrapolate information about the function of a newly discovered sequence by comparing it to annotated sequences.

  18. Does it make sense? • All functional information is ultimately contained within the sequence. • Proteins are evolutionary related: • Selective pressure is on function, and thus on residues with functional role (eg: active site or structural key residues are conserved). • Modular nature of proteins. • Two sequences have the same structure if corresponding residues are similar enough on physico-chemical level.

  19. Application of sequence alignment • Determining function of newly discovered genetic or protein sequences. • Identification of functional patterns/domains. • Predicting structure of proteins. • Determining evolutionaryrelationships among genes, proteins, and entire species. Aligning and comparing sequences, and searching databases for similar sequences – a cornerstone of bioinformatics!!

  20. Pairwise alignment Pairwise alignment = identification of residue-residue correspondence. For the alignment to be meaningful, the correspondence should reflect the functional or evolutionary relationship What criteria should we use to obtain biologically meaningful alignments? ????? 101 AGVIGTILLISYGIRRLIKKSPSDVKP 115 ||:||.|||::|..|||.|:.|:||.| GLP_HORSE 60 AGIIGIILLLAYVSRRLRKRPPADVPP 86

  21. Terminology • Identity: • percentage of pairs of identical residues between two aligned sequences. • Similarity: • percentage of pairs of similar residues between two aligned sequences. • one must define what similar means. Eg: • as observed in well studied evolutionary related protein families, • physico-chemical amino acid properties: hydropathy, size, … • Homology: • two sequences are homologous if and only if they have a common ancestor. • it´s either yes or no. • Two types: orthology and paralogy • not to be confused with similarity! • don’t mix up with analogy

  22. DotPlot • The simplest way of comparing two sequences: • A dot is placed where both sequence elements are identical. • Gives an overview of all possible alignments. • Each diagonal indicates a possible (ungapped) alignment

  23. Filtering Out the Noise in Dotplots • Dots may be scored according to a sliding window and a similarity cutoff to reduce noise: • The smaller the window, the more noise. • With large windows, the sensitivity for short sequences is reduced. Window size = 5, Similarity cutoff = 3 LETVHKKLYAGQYQNAGQFCDDIWLMLDNA L S T I K R K L D T G * Q * Y Q E P W Q … LETVHKKLYAGQYQNAGQFCDDIWLMLDNA | | || |||| | || ||| | LSTIKRKLDTGQYQEPWQYVDDVWLMFNN LETVHKKLYAGQYQNAGQFCDDIWLMLDNA L S T I K R K L D * T G Q * Y Q E P W Q … LETVHKKLYAGQYQNAGQFCDDIWLMLDNA | | || |||| | || ||| | LSTIKRKLDTGQYQEPWQYVDDVWLMFNN LETVHKKLYAGQYQNAGQFCDDIWLMLDNA | | || |||| | || ||| | LSTIKRKLDTGQYQEPWQYVDDVWLMFNN

  24. Dotlet At http://www.isrec.isb-sib.ch/java/dotlet/Dotlet.html Let´s find repeated domains in the following sequence : > SLIT_DROME (P24014): MAAPSRTTLMPPPFRLQLRLLILPILLLLRHDAVHAEPYSGGFGSSAVSSGGLGSVGIHIPGGGVGVITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAPYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTDVRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLRLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSMKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCSWGELRMKLSGECRMDSDCPAMCHCEGTTVDCTGRRLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNCHLAWFAECVRKKSLNGGAARCGAPSKVRDVQIKDLPHSEFKCSSENSEGCLGDGYCPPSCTCTGTVVACSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVVSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVCRGRVRNDILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNATCTVLEEGRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAKCMDHFTHYSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCEGHNMISMMYPQTSPCQNHECKHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLRTRPEANVTIVFSSAEQNGILMYDGQDAHLAVELFNGRIRVSYDVGNHPVSTMYSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINEGSNDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSFKGCMKEVWINHKLVDFGNAQRQQKITPGCALLEGEQQEEEDDEQDFMDETPHIKEEPVDPCLENKCRRGSRCVPNSNARDGYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYYTENDCRSRQPLKYAKCVGGCGNQCCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKCY

  25. DotPlot summary • Comparing a sequence with itself, can be used to identify: • Repeated domains, • Regions of low complexity (eg, …GYCAAAAAAAAALK…). • Comparing two protein sequences, can be used to identify: • Local regions of similarity, • Conserved protein domains.

  26. The Pairwise Alignment Problem • Lign up diagonal by edit operations: • substitution (mutation) • gap or indel (insertion/deletion) sequence 1 substitution sequence 2 deletion seq1 IGTILLISYGIRRLIKKSPSDVKP----LPSPDTDVP || ||| | ||| | | || | || | | seq2 IGIILLLAYVSRRLRKRPPADVPPPASTVPSADAPPP gap insertion But there are many ways to align 2 sequences  we need to score alignments to decide which is the best.

  27. Scoring the Edit Operations • For example: • identical: +10 (it´s good) • substitution: +2 for S-A, -1 for K-P, … • gap: -3 PSDVKP--P | || | | PADVPPPAP Score: +50+2-1+2*(-3) = 45 Choosing an appropriate scoring scheme: where biological information is introduced (eg, reward the evolutionary most likely alignment). Standard notation: • | for identical • : for very similar (eg, size and hydropathy) • . for somewhat similar (eg, size or hydropathy)

  28. Gap penalty TIL--------LISYGIRRLIK TILKKSPSDVKLISYGIRRLIK • Different scores for • gap opening, eg: -5 • gap extension, eg: L*(-1) with L=length of extension • gap opening > gap extension Few long gaps is better than IG-TI--LYDL-SYYAG---IR IGKIIPRL--LVAY--VLIGSR many small gaps gap opening gap extension TIL--------LISYGIRRLIK TILKKSPSDVKLISYGIRRLIK gap score= -5 -6

  29. Gap penalty • Can also consider special penalty for gaps at end/beginning of alignment (eg, zero penalty). • Need to be careful in adjusting the gap score to the substitution score: • too strong penalty  no gaps, • too weak penalty  too many gaps. • Insertions and deletions have been found to occur in nature at significantly lower frequency than mutations.

  30. Residue Substitution • A substitution score for each aa pair  a substitution matrix. • Most used: based on evolutionary relationship. • Two types: • PAM series, • BLOSUM series.

  31. PAM (Percent Accepted Mutation) PAM250 • PAM1: observed mutations in carefully selected sets of closely related proteins (1572 sequences from 71 families). (1978) • Idea: observed substitutions are the result of 1 mutation (not many). • PAMn: iterate PAM1 n times to obtain substitution rate between more divergent sequences. Use when PAM: 0 30 80 110 200 250 %identity: 100 75 60 50 25 20

  32. BLOSUM (BLOck Substitution Matrix) • Based on a larger set than PAM is. • More recent than PAM. (1992) • Different approach than PAM: • not based on an explicit evolutionary model, • observed aa substitutions in a set of conserved aa patterns called blocks. • BLOSUMn: fromblocks which are n% identical. • BLOSUM62: empirically shown to be among the best at detecting weak similarity. BLOSUM62

  33. BLOSUM 80 BLOSUM 62 BLOSUM 45 PAM 1 PAM 120 PAM 250 Less divergent More divergent Tips for using substitution matrices • Generally, BLOSUM matrices perform better than PAM for local similarity searches. • For database searches, the most commonly used matrix is BLOSUM62. • When comparing closely related proteins, one should use lower PAM or higher BLOSUM, for distantly related proteins higher PAM or lower BLOSUM matrices • Caution: substitution matrices are statistical in nature. In a given alignment, a substitution may or may not correspond to an actual mutation.

  34. Pairwise Alignment Algorithms • Given a scoring scheme, an alignment algorithm tries to find the best alignment between 2 sequences according to that scheme. • Exact algorithms: • guaranteed to return an alignment with the best possible score. • Heuristic alignments: • not guaranteed to return best alignments. • but they are quicker (and hopefully still return good alignments). • Two types of alignment: • Global: forced over the entire length of 2 sequences. • Local: between substrings of 2 sequences..

  35. Global vs Local Alignment • Global alignments: • are sensitive to gap penalties, • Assumes homology. • Outputs everything – either matches or gaps • can be used to compare 2 proteins with same function (in, eg, human/mouse). • Local alignments: • Can be used to look for conserved domains or motifs in 2 proteins, • search for local similarities in large sequences, • database searches, • scanning an entire genome with a short sequence. • Does not output everything – only the best hits

  36. Exact Algorithms: Dynamic Programming How can we find the best alignment between 2 sequences? • Exhaustive search among all possible alignments is not possible (eg, for 2 sequences of 100 and 95 residues: 55 millions possible alignments with 5 gaps). • Problem solved by dynamic programming: • initialize top row and left column, • compute best local scores iteratively, • keep track of where best local score comes from, • traceback to obtain the best alignments. • May exist several best solutions: an alignment reported to you may be one among a number of possibilities. best global score Example of 2 best solutions: ATTCTCTGA -TAC--TGA ATTCTCTGA -TA--CTGA The example is from www.pasteur.fr

  37. Local and global Alignment Servers (Exact Algorithm) Use the Needleman-Wunsch algorithm (1970) and the Smith-Waterman algorithm (1981). • Server at EBI: EMBOSS-Align • Let´s submit to http://www.ebi.ac.uk/emboss/align/index.html the sequence : >uniprot|P35858|ALS_HUMAN Insulin-like growth factor-binding protein complex MALRKGGLALALLLLSWVALGPRSLEGADPGTPGEAEGPACPAACVCSYDDDADELSVFC SSRNLTRLPDGVPGGTQALWLDGNNLSSVPPAAFQNLSSLGFLNLQGGQLGSLEPQALLG LENLCHLHLERNQLRSLALGTFAHTPALASLGLSNNRLSRLEDGLFEGLGSLWDLNLGWN SLAVLPDAAFRGLGSLRELVLAGNRLAYLQPALFSGLAELRELDLSRNALRAIKANVFVQ LPRLQKLYLDRNLIAAVAPGAFLGLKALRWLDLSHNRVAGLLEDTFPGLLGLRVLRLSHN AIASLRPRTFKDLHFLEELQLGHNRIRQLAERSFEGLGQLEVLTLDHNQLQEVKAGAFLG LTNVAVMNLSGNCLRNLPEQVFRGLGKLHSLHLEGSCLGRIRPHTFTGLSGLRRLFLKDN GLVGIEEQSLWGLAELLELDLTSNQLTHLPHRLFQGLGKLEYLLLSRNRLAELPADALGP LQRAFWLDVSHNRLEALPNSLLAPLGRLRYLSLRNNSLRTFTPQPPGLERLWLEGNPWDC GCPLKALRDFALQNPSAVPRFVQAICEGDDCQPPAYTYNNITCASPPEVVGLDLRDLSEA HFAPC >uniprot|O08770|GPV_RAT Platelet glycoprotein V precursor (GPV) (CD42D). MLRSVLLSAVLSLVGAQPFPCPKTCKCVVRDAVQCSGGSVAHIAELGLPTNLTHILLFRM DRGVLQSHSFSGMTVLQRLMLSDSHISAIDPGTFNDLVKLKTLRLTRNKISHLPRAILDK MVLLEQLFLDHNALRDLDQNLFQKLLNLRDLCLNQNQLSFLPANLFSSLGKLKVLDLSRN NLTHLPQGLLGAQIKLEKLLLYSNRLMSLDSGLLANLGALTELRLERNHLRSIAPGAFDS LGNLSTLTLSGNLLESLPPALFLHVSWLTRLTLFENPLEELPEVLFGEMAGLRELWLNGT HLRTLPAAAFRNLSGLQTLGLTRNPLLSALPPGMFHGLTELRVLAVHTNALEELPEDALR GLGRLRQVSLRHNRLRALPRTLFRNLSSLVTVQLEHNQLKTLPGDVFAALPQLTRVLLGH NPWLCDCGLWPFLQWLRHHLELLGRDEPPQCNGPESRASLTFWELLQGDQWCPSSRGLPP DPPTENALKAPDPTQRPNSSQSWAWVQLVARGESPDNRFYWNLYILLLIAQATIAGFIVF AMIKIGQLFRTLIREELLFEAMGKSSN

  38. Heuristic Algorithms • Motivations: • Exact algorithms are exhaustive but computationally expensive. • Exact algorithms are impractical for comparing a query sequence to millions of other sequences in a database (database scanning), • and so, database scanning requires faster alignment algorithm (at the cost of optimality).

  39. Heuristic Algorithms • Probing a database with a query is similar to aligning a query with a very long sequence. • Main idea: • Use dynamic programming, but limited to (sub-)sequences which are likely to produce interesting alignments with the query. • Heuristic part of the algorithm: eliminate from search uninteresting sequences (need to make a guess). • Algorithms: • FASTA : Lipman-Pearson (1985). • BLAST (Basic Local Alignment Search Tool) : Altshul et al. (1990).  need fast local alignment methods.

  40. BLAST Overview • Many versions for different query-database cases: • blastp: protein - protein • blastn: nucleotide - nucleotide • blastx: nucleotide  protein - protein • tblastn: protein - protein  nucleotide • tblastx: nucleotide  protein - protein  nucleotide • Comes in many flavours. • Fast and reliable. • Easy to use.

  41. BLAST Overview • BLAST computes “an alignment”, not necessarily the exact optimal alignment. • Given the query and the database (long sequence): • Find all words of length k (default: k=3 for AA and k=11 for DNA) that match the query with a score high enough. • Look for subsequences in the database that contain these words. • Extend subsequences to see if match score can be increased. • Compute total score when no more extensions are possible. • Rank the alignments.

  42. BLAST at NCBI >1IGR:A INSULIN-LIKE GROWTH FACTOR RECEPTOR EICGPGIDIRNDYQQLKRLENCTVIEGYLHILLISKAEDYRSYR FPKLTVITEYSLGDLFPNLTVIRGWKLFYNYALVIFEMTNLKDI GLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGN KPPKECGDLCPGTMEEKPMCEKTTINNEYNYRCWTTNRCQKMCP STCGKRACTENNECCHPECLGSCSAPDNDTACVACRHYYYAGVC VPACPPNTYRFEGWRCVDRDFCANILSAESSDSEGFVIHDGECM QECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQ MLQGCTIFKGNLLINIRRGNNIASELENFMGLIEVVTGYVKIRH SHALVSLSFLKNLRLILGEEQLEGNYSFYVLDNQNLQQLWDWDH RNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTR NNGERASCESDVDDDDKEQKLISEEDLN Let´s submit the query sequence At http://www.ncbi.nlm.nih.gov/BLAST/

  43. Bit score: S’ The value S’ is derived from the raw alignment score S, but statistical properties of the scoring system have been taken into account. Because bit scores are normalised w.r.t. scoring system, they can be used to compare alignment scores from different searches. E value: Expectation value. Expected # of alignments with scores equivalent to or better than S to occur by chance. The lower the E value, the more significant the score. NCBI Blast output help: http://www.ncbi.nlm.nih.gov/Education/BLASTinfo/Blast_output.html

  44. BLAST servers • Pairwise alignment: • BLAST: http://www.ncbi.nlm.nih.gov/blast/bl2seq/wblast2.cgi • Database screening: • BLAST: • http://www.ncbi.nlm.nih.gov/BLAST/ • http://www.ebi.ac.uk/blast/index.html • http://www.ch.embnet.org/software/bBLAST.html • http://www.ch.embnet.org/software/aBLAST.html Remark: there is a server with a powerful implementation of Smith-Waterman for database screening: http://www.ebi.ac.uk/MPsrch/. Runs about 50 times slower, but is more sensitive and returns less false positives than Blast.

  45. PSI-BLAST • Position-Specific Iterated Blast: • More sensitive, ie better at detecting distant relationships, than BLAST. • Computes position-specific substitution matrices (PSSMs) to score matches between query and database sequences. (Blast uses precomputed substitution matrices, eg BLOSUM62.)

  46. PSI-BLAST • Repeatedly searches the target databases. • At each round: • compute a multiple alignment of high scoring sequences to generate a new PSSM for next round of searching. • Iterates until no new sequences found (or until a maximal number of iteration is reached).

  47. Significance of Alignments • Scores cannot be used to rank alignments: • a bad but long alignment may have a higher score than a good but short alignment. • We need a normalized scoring scheme that would allow to compare alignments, and evaluate their biological significance. • Idea: • Probe the database with random sequences. • This gives a distribution of scores (it follows the extreme-value distribution). • Establish a threshold for significance.

  48. Extreme-Value Distribution Score distribution for random sequences probability that the score of our query is no better than random: P-value score score of our query Difficulty: finding a significance threshold.

  49. Quantifying the Significance of Alignments For an alignment with raw score S: • P-value: • The probability of an alignment occurring with score S or better if the aligned-against sequence is random. • The lower the P-value, the more significant the alignment. • E-value: • Expected number of alignments with scores equivalent to or better than S to occur by chance only. • The lower the E-value, the more significant the alignment. • E-value = P-value * size of database.

  50. Rough Guide for P-values and E-values • P-Value (reported by many programs): 0 ≤ P-val ≤ 1 • E-value (reported by some programs, eg PSI-Blast): 0 ≤ E-val ≤ size of database

More Related
SlideServe
Audio
Live Player
Audio Wave
Play slide audio to activate visualizer