180 likes | 778 Vues
Neural Network training. Morten Nielsen, CBS, BioCentrum, DTU. Neural network programs. How Classification neural network Howlin Real value neural network Nnlinplayer Neural network player i.e. no training. How2doit. How and howlin clumsy but very fast and efficient Fortran programs
E N D
Neural Network training Morten Nielsen, CBS, BioCentrum, DTU
Neural network programs • How • Classification neural network • Howlin • Real value neural network • Nnlinplayer • Neural network player i.e. no training
How2doit • How and howlin clumsy but very fast and efficient Fortran programs • Three important files • Parameter file; howlin.dat • Data file • Synaps (weight) file
Output • Format of output file • Plotting training and test performance • howlinplot fileout
Neural networks • Neural networks can learn higher order correlations! • What does this mean? 0 0 => 0 0 1 => 1 1 0 => 1 1 1 => 0 No linear function can learn this pattern
Neural networks w21 w12 w11 w22 v1 v2 w11=1, w12=-1 w21=1 w22=-1 V1 = 0.5 v2= -0.5
nnlinplayer • Use weight file(s) to generate neural network predictions • Format • nnlinplayer synapsfilelistinputfile • Makes consensus prediction over N neural networks • Input file must be generated separately • seq2inp data • Using pipes • seq2inp data | nnlinplayet synlist --
how • Classification network • Generates input data directly from sequence • RIISSIEQKEENKGGEDKLKMIREYRQMVE • Input is how files
Useful programs • fasta2pep • seq2inp • ranlines • splitfile • balanceset • xycorr • Examples fasta2pep ex.fsa | grep -v # | seq2inp -- | grep -v # | ranlines -- | grep -v # | splitfile -nc 4 -- seq2inp data | nnlinplayer synlist -- | grep -v # | args 1,3 | xycorr
Exercises • Copy all files from • /usr/opt/www/pub/CBS/researchgroups/immunology/intro/NeuralNetworks/exercise/* to some directory • Open the file doit • What does the program do? • Run the program and save the output to a file named datafile • Make a howlin neural network training • Set the number of hidden neurons in the howlin2002.dat file to 0 • Run the training typing • howlin2002 < howlin2002.dat > output • Plot the training/test performance using the howlinplot program • Redo the training using 2 hidden neurons • Check the synaps file. What are the weight values? • Do the prediction of T cell epitopes exercise www.cbs.dtu.dk/courses/27485.imm/exercise5/index.php