240 likes | 662 Vues
Protein kinases. Before we describe how protein kinases work, first an interlude dealing with the representation of protein structure. Proteins are made of a chain (or chains ) of covalently bound amino acids.
E N D
Protein kinases Before we describe how protein kinases work, first an interlude dealing with the representation of protein structure
Proteins are made of a chain (or chains) of covalentlyboundaminoacids
Proteins are made of a chain (or chains) of covalentlyboundaminoacids
The -N-C-C-N-C-C- acts as the main chain or « backbone » the atom groups thatdefine the type of aminoacidform the « sidechains » Backbone representation
The string of aminoacidsfoldseither in the form of a helix, a b-strand or as a non-structuredloop (not shown)
An example of a short polypeptide comprisinga-helices, b-sheets and loops loop a-helix b-sheet
The aminoacidsequence of a protein kinase >P06213| 1023-1298 (=275 amino acids) ...ITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFT CHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAE IADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRW MAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCP ERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSF…
The folded string of the aminoacidsthatconstitute a protein kinase canberepresented in differentways Show all atoms of the amino acid in a stick representation Show only the back-bone of the amino acid in a ribbon representation Show all atoms of the amino acid in a sphere representation Show the surface of the protein
Phosphorylation and dephosphorylation : protein kinases and protein phosphatases
Protein kinases What do they do? What do they look like? How do they do it?
This is what they look like Understanding enzymes as nano-machines; ATP isnicelyburiedinside the protein kinase whereas the substrate (only a short peptide shown in blue) isfixed onto the surface of the protein The tyrosine residue, shown in green, isperfectlypositioned to receive the g-phosphate tyrosine containing substrate ATP
This is what they look like Understanding enzymes as nano-machines; Protein kinases have two lobes, the upper one is the N-terminal lobe, the bottom one the C-terminal lobe. the catalyticcleftsitsat the interphase between the two; the calaticresidue (not shown) as well as ATP reside in the cleft (ready for action) N-terminal lobe ATP catalytic cleft C-terminal lobe
Understanding enzymes as nano-machines; A ribbonrepresentationtwoillustrate the position of highlyconservedaminoacids As theirlevel of conservation indicates, theseaminoacids are vital for the functioning of the protein kinase They control the position of ATP (lys, asp, glu), substrate (blueribbon) and the transfer of electrons (asp*) leading to hydrolysis of ATP *
And thisis how they do it(understanding enzymes as nano-machines)
Kinases exist in an incompetent state and require activation beforetheycanphosphorylatesubstrate