1 / 18

Setting The Biological Scene

Introducing DNA, RNA, polypeptides, proteins and sequence analysis. Setting The Biological Scene. Introducing Biological Sequence Analysis. figAANDT.eps. Adenine and Thymine Nucleotide Bases. figGANDC.eps. Guanine and Cytosine Nucleotide Bases. figDOUBLEHELIX.eps. The DNA “double helix”.

alysej
Télécharger la présentation

Setting The Biological Scene

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. Introducing DNA, RNA, polypeptides, proteins and sequence analysis Setting The Biological Scene

  2. Introducing Biological Sequence Analysis

  3. figAANDT.eps Adenine and Thymine Nucleotide Bases

  4. figGANDC.eps Guanine and Cytosine Nucleotide Bases

  5. figDOUBLEHELIX.eps The DNA “double helix”

  6. Protein and Polypetides

  7. figTRIAD.eps The Catalytic Triad of Chymotrypsin (PDB ID: 1AFQ)

  8. Generalised Models and Their Use

  9. figDOGMA.eps The Central Dogma of Molecular Biology

  10. Transcription and Translation • Transcription • Translation

  11. The Emboss/Transeq Website http://www.ebi.ac.uk/emboss/transeq/

  12. figEMBOSSTRANSEQ.eps EBI's EMBOSS/Transeq

  13. Input and Results ggatttccct acgtcatgcc atttttctat taatcacagg agttcatcat gaaaaaactg 1560 tttgcctctc tcgccatcgc tgccgttgtt gcccccgtgt gggccgccac ccagaccgtc 1620 acgctgtccg taccgggcat gacctgctcc gcttgtccga tcaccgttaa gaaggcgatt 1680 tccaaggtcg aaggcgtcag caaagttaac gtgaccttcg agacacgcga agcggttgtc 1740 accttcgatg atgccaagac cagcgtgcag aagctgacca aggccaccga agacgcgggc 1800 tatccgtcca gcgtcaagaa gtgaggcact gaaaacggca gcgcagcaca tctgacgccc 1860 GFPYVMPFFY*SQEFIMKKLFASLAIAAVVAPVWAATQTVTLSVPGMTCSACPITVKKAISKVEGVSKVNVTFETREAVVTFDDAKTSVQKLTKATEDAGYPSSVKK*GTENGSAAHLTP

  14. Input and Results FT CDS 1549..1824 FT /codon_start=1 FT /db_xref="GOA:P13113" FT /db_xref="SWISS-PROT:P13113" FT /transl_table=11 FT /gene="merP" FT /product="mercury resistance protein" FT /protein_id="AAA98223.1" FT /translation="MKKLFASLAIAAVVAPVWAATQTVTLSVPGMTCSACPITVKKAIS FT KVEGVSKVNVTFETREAVVTFDDAKTSVQKLTKATEDAGYPSSVKK"

  15. Genome Sequencing • Sequence assembly • The Example DNA-Gene-Protein

  16. figMEROPERON.eps The Mer Operon Example DNA-Gene-Protein

  17. More Information on Mer Operon http://www.uga.edu/cms/FacAOS.html

  18. Where To From Here

More Related