amiel
Uploaded by
84 SLIDES
1102 VUES
840LIKES

RNA/Protein Structures

DESCRIPTION

RNA/Protein Structures. RNA structure. Stem-loop structure. RNA structure. A loop structure A loop between i and j when base at i pairs with base at j Base at i+1 pairs with at base j Or base at i pairs with base at j-1 Or a multiple loop. RNA secondary structure.

1 / 84

Télécharger la présentation

RNA/Protein Structures

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. RNA/Protein Structures

  2. RNA structure • Stem-loop structure

  3. RNA structure • A loop structure • A loop between i and j when base at i pairs with base at j • Base at i+1 pairs with at base j • Or base at i pairs with base at j-1 • Or a multiple loop

  4. RNA secondary structure • Search for minimum free energy • Gibbs free energy at 37 degrees (C) • Free energy increments of base pairs are counted as stacks of adjacent pairs • Successive CGs: -3.3 kcal/mol • Unfavorable loop initiation energy to constrain bases in a loop

  5. RNA structure prediction • Ad-hoc approach • Simply look at a strand and find areas where base pairing can occur • Possible to find many locations where folds can occur • Prediction should be able to determine the most likely one • What should be the criteria ? • 1980, Nussinov-Jacobson Algorithm • More stable one is the most likely structure • Find the fold that forms the greatest number of base pairs (base-pairing lowers the overall energy of the strand, more stable) • Checking for all possible folds is impossible -> dynamic programming

  6. Amino Acid • General structure of amino acids • an amino group • a carboxyl group • α-carbon bonded to a hydrogen and a side-chain group, R • Side chain R determines the identity of particular amino acid • R: large white and gray • C: black • Nitrogen: blue • Oxygen: red • Hydrogen: white

  7. Protein • Protein: polymer consisting of AA’s linked by peptide bonds • AA in a polymer is called a residue • Folded into 3D structures • Structure of protein determines its function • Primary structure: linear arrangement of AA’s • AA sequence (primary structure) determines 3D structure of a protein, which in turn determines its properties • N- and C-terminal • Secondary structure: short stretches of AAs • Tertiary structure: overall 3D structure

  8. Protein Structures

  9. Secondary structure • Secondary structures have repetitive interactions resulting from hydrogen bonding between N-H and carboxyl groups of peptide backbone • Conformations of side chains of AA are not part of the secondary structure • α-helix

  10. β-pleated sheet • Parallel/antiparallel • 3D form of antiparallel

  11. Secondary structure: domain • Part of chain folds independently of foldings of other parts • Such independent folded protion of protein is called domain (super-secondary structure) •  α  unit • α α unit (helix-turn-helix) •  meander • Greek key

  12. Domain • Larger proteins are modular • Their structural units, domains or folds, can be covalently linked to generate multi-domain proteins • Domains are not only structurally, but also functionally, discrete units – domain family members are structurally and functionally conserved and recombined in complex ways during evolution • Domains can be seen as the units of evolution • Novelty in protein function often arises as a result of gain or loss of domains, or by re-shuffling existing domains along sequence • Pairs of protein domains with the same 3D fold, precise function is conserved to ~40% sequence identity (broad functional class is conserved ~20%)

  13. Motif • Repetitive super-secondary structures is a motif (or module) • Greek key motif is often found in –barrel tertiary structure • complement control protein module • Immunoglobulin module • Fibronectin type I module • Growth factor module • Kringle module

  14. Motif Representation • Motif • In multiple alignments of distinctly related sequences, highly conserved regions are called motifs, features, signatures or blocks • Tends to correspond to core structural and functional elements of the proteins

  15. Linked series of -meanders • Greek key pattern • Alternative  α  untis • Top and side views (α-helical • section is outside)

  16. Secondary structure: conformation • Two types of Protein Conformations • Fibrous • Globular –folds back onto itself to create a spherical shape • Schematic diagrams of fibrous and globular proteins • Computer-generated model of globular protein

  17. SRC protein • Tyrosine kinase • Enzyme putting a phophate group on tyrosine AA (phosphorylation) • Activates an inactive protein, eventually activates cell-division proteins

  18. Secondary Structure Prediction by PSIRED • Prediction of regions of the protein that form alpha-helix, beta-sheet, or random coil • NP_005408 >gi|4885609|ref|NP_005408.1| proto-oncogene tyrosine-protein kinase Src [Homo sapiens] MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSS DTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYV APSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKL DSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGC FGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLL DFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPEC PESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL

  19. Examining Crystal Structure • Cn3D: NCBI structure viewer and modeling tool • DeppView: SWISSPRROT • JMOL • NCBI Structure database • Links to NCBI MMDB (Molecular Modeling Database) • MMDB contains experimentally verified protein structures • SRC – MMDB ID 56157, PDB ID 1FMK • View Structure from NCBI Structure database • Opens up Cn3D window • Click to rotate; Ctrl_click to zoom; Shift_clcik to move • Rendering and coloring menus

  20. Tertiary structure • 3D arrangment of all atoms in the module • Considers arrangement of helical and sheet sections, conformations of side chains, arrangement of atoms of side chains, etc. • Experimentally determined by • X-ray crystallography – measure diffraction patterns of atoms • NMR (Nuclear Magnetic Resonance) spectroscopy – use protein samples in aqueous solution

  21. Tertiary structure of α-lactalbumin myoglobin

  22. Protein families • Groups of genes of identical or similar sequence are common • Sometimes, repetition of identical sequences is correlated with the synthesis of increased quantities of a gene product • e.g., a genome contains multiple copies of ribosomal RNAs • Human chromosome 1 has 2000 genes for 5S rRNA (sedimentation coefficient), and chr 13, 14, 15, 21 and 22 have 280 copies of a repeat unit made up of 28S, 5.8S and 18S • Amplication of rRNA genes evolved because of heavy demand for rRNA synthesis during cell division • These rRNA genes are examples of protein families having identical or near identical sequences • Sequence similarities indicate a common evolutionary origin • α- and β-globin families have distinct sequence similarities evolved from a single ancestral globin gene

  23. Protein families and superfamilies • Dayhoff classification, 1978 • Protein families – at least 50 % AA sequence similar (based on physico-chemical AA features) • Related proteins with less similarity (35%) belong to a superfamily, may have quite diverse functions • α- and β-globins are classified as two separate families, and together with myoglobins form the globin superfamily • families have distinct sequence similarities evolved from a single ancestral globin gene

  24. Protein family database • Pattern or secondary database derived from sequences • a pattern may be the most conserved aspects of sequence families • The most conserved part may vary between species • Use scoring system to account for some variability • Position-specific scoring matrix (PSSM) or Profile • Contrast to a pairwise alignment, having the same weight regardless of positions • Protein family databases are derived by different analytical techniques • But, trying to find motifs, conserved regions, considered to reflect shared structural or functional characteristics • Three groups: single motifs, multiple motifs, or full domain alignments

  25. Protein family databases • Pattern or secondary database derived from sequences

  26. Single Motif Method • Regular expression • PROSITE • PDB 1ivy • Carboxypet_Ser_His (PS00560) • [LIVF]-x2-[[LIVSTA]-x[IVPST]-[GSDNQL]-[SAGV]-[SG]-H-x-[IVAQ]-P-x(3)-[PSA] • [] – any of the enclosed symbols • X- any residue • (3) – number of repeats • Fuzzy regular expression • Build regular expressions with info on shared biochemical properties of AA • Provide flexibility according to AA group clustering

  27. Multiple motif methods • PRINTS • Encode multiple motifs (called fingerprints) in ungapped, unweighted local aligments • BLOCKS • Derived from PROSITE and PRINTS • Use the most highly conserved regions in protein families in PROSITE • Use motif-finding algorithm to generate a large number of candidate blocks • Initially, three conserved AA positions anywhere in the alignment are identified and used as anchors • Blocks are iteratively extended and ultimately encoded as ungapped local alignments • Graph theory is used to assemble a best set of blocks for a given family • Use position specific scoring matrix (PSSM), similar to a profile

  28. Full domain alignment • Profiles • Use family-based scoring matrix via dynamic programming • Has position-specific info on insertions and deletions in the sequence family • Hidden Markov Model (HMM) • PFAM, SMART, TIGRFAM represent full domain alignments as HMMs • PFAM • Represents each family as seed alignment, full alignment, and an HMM • Seed contains representative members of the family • Full alignment contains all members of the family as detected with HMM constructed from seen alignment

  29. Hidden Markov Model (HMM) • Markov Process • Decomposed into a successive discrete states • e.g., first-order Markov process – a traffic light • Process states are not directly observable – spoken sounds vs. physical changes in vocal chords, position of tongue, etc. • Profile HMM • Discrete states correspond to successive columns of protein multiple sequence alignment • Match, insertion, deletion states • States have associated symbol emission probability distribution • Position-specific gap weight represents transition probability from indel to match

  30. Protein StructureComparison/Classification

  31. Protein structures • Domain • Polypeptide chain in a protein folds into a ‘tertiary’ structure • One or more compact globular regions called domains • The tertiary structure associated with a domain region is also described as a protein fold • Multi-domain • Proteins with polypeptide chains fold into several domains • Nearly half the known globular structures are multidomain, more than half in two domains • Automatic structure comparison methods are introduced in 1970s shortly after the first crystal structures are stored in PDB

  32. Reasons for structural comparisons • Ligand binding • Binding of ligand or a substrate to an active-site in a protein induces a structural change which facilitates the reaction being catalyed at the site or promotes a binding of substrates at another site • Comparing bound and unbound structures of ligand sheds light on these processes and drug designs. • Distant evolutionary relationship • Protein structure is more highly conserved than sequence • Structure comparison can detect homologs with substantial changes • Structural variations in protein families • Identification of common structural motifs

  33. Structure comparison algorithms • Two main components in structure comparison algorithms • Scoring similarities in structural features • Optimization strategy maximizing similarities measured • Most are based on geometric properties from 3D coordinates • Intermolecular method • Superpose structures by minimizing distance between superposed position • Intra • Compare sets of internal distances between positions to identify an alignment maximizing the number of equivalent positions • Distance is described by RMSD (Root Mean Square Deviation), squared root of the average squared distance between equivalent atoms

  34. Inter vs. Intra

  35. RMSD

  36. Distant homolog • Structure is more conserved than sequences during evolution • Structural similarity between distant homologs can be found • Pairwise sequence similarity • SSAP structural similarity score in parenthesis (0 – 100)

  37. Distant homolog

  38. Structural variations in protein families

  39. Structure comparison algorithms • SSAP, 1989 • Residue level, Intra, Dynamic programming • DALI, 1993 • Residue fragment level, intra, Monte Carlo optimization • COMPARER, 1990 • Multiple element level, both, Dynamic programming

  40. Structure classification • Most structure classifications are established at the domain level • Thought to be an important evolutionary unit and easier to determine domain boundaries from structural data than from sequence data • Criteria for assessing domain regions within a structure • The domain possesses a compact globular structure • Residues within a domain make more internal contacts than to residues in the rest of polypeptide • Secondary structure elements are usually not shared with other regions of the polypeptide • There is evidence for existence of this region as an evolutionary unit

  41. CATH classifications

  42. Multi-domain structures

  43. Structure classification hierarchy • Class level -- proteins are grouped according to their structural class (composition of residues in a α -helical and β-strand conformations) • Mainly- α, mainly- β, alternating α- β, α plus β (mainly- α and – β are segregated) • Architecture • the manner by which secondary structure elements are packed together (arrangement of sec. structures in 3D space) • Fold group (topology) • Orientation of sec. structures and the connectivity between them • Superfamily • Family

  44. Hierarchy example

  45. Protein Structure databases • PDB • Over 20,000 entries deduced from X-ray diffraction, NMR or modeling • Massively redundant • 1FMK, 1BK5, 2F9C, .. • SCOP (Structural Classification of Proteins) • Multi-domain protein is split into its constituent domains • Known structures are classified according to evolutionary and structural relationship • Domains in SCOP are grouped by species and hierarchically classified into families, superfamilies, folds and classes • Family level – group together domains with celar sequence similarities • Superfamily – group of domains with structural and functional evidence for their descent from a common evolutionary ancestor • Gold – group of domains with the same major secondary structure with the same chain topology • Domains identified manually by visually inspecting structures

  46. Protein Structure databases • SCOP (cont’d) • Proteins in the same superfamily often have the same function • CATH (Class, Architecture, Topology, Homology) • Homology – clustered domains with 35% sequence identity and shared common ancestry • 800 fold families, 10 of which are super-folds • 2009 www.cs.uml.edu/~kim/580/08_cath.pdf

  47. Protein Function/StructurePrediction

  48. Protein Function Prediction • In the absense of experimental data, function of a protein is usually inferred from its sequence similarity to a protein of known function • The more similar the sequence, the more similar the function is likely to be • Not always true • Can clues to function be derived directly from 3D structure • Definition of function • Function can be described at many levels: biochemical, biological processes, pathways, organ level • Proteins are annotated at different degrees of functional specificity: ubiquitin-like dome, signaling protein, .. • GO (Gene Ontology) scheme

  49. Protein Function Prediction • Sequence-based – largely unreliable • Profile-based • Profiles are constructed from sequences of whole protein families with families are grouped by 3D structure or function (as in Pfam) • Start with sequences matched by an initial search, iteratively pull in more remote homologues • More sensitivity than simple sequence comparison because profiles implicitly contain information on which residues within the family are well conserved and which sites are more variable • Structure-based • Fold-based • Proteins sharing simlar functions often shave similar folds, resulting from descent from a common ancestral protein • Sometimes, function of proteins alter during evolution with the folds unchanged • Thus, fold match is not always reliable • Surface clefts and binding pockets

More Related
SlideServe
Audio
Live Player
Audio Wave
Play slide audio to activate visualizer