130 likes | 154 Vues
Learn about the latest updates in research data management from Munich institutions and get insights into sensitive data projects. Topics include metadata, rights management, electronic lab notebooks, PID systems, and research software engineering.
E N D
Research Data Management in Munichupdatesfromrdmuc (LMU-LRZ-TUM+x)+ glimpse on first sensitive-dataprojects at LRZ U. Eisold, M. Hora, T. Mader, C. Wolter (TUM)S. Kümmet, J. Penagos, V. Schallehn, J. Schulz , M. Spenger, A. Weiss (LMU)A. Stanzel (BSB)R. García, A. Götz, S. Hachinger, N.J. Hammer, M. Hayek, J. Munke, H. Nguyen, R. Pichler, M. Sharikadze, T. Weber (LRZ) 23.10.2019 | RDA 14th Plenary Meeting – RDARI IG Meeting
rdmuc – Working Group • Meetings on a regularbasisfor a betternetworkingofMunichinstitutionsworkingon researchdatamanagement • Participants: • Bavarian State Library • LMU Center for Digital Humanities(ITG) • Leibniz Supercomputing Centre / GeRDIproject • University Library of the Ludwig-Maximilians-UniversitätMünchen • University Library of the Technical University of Munich • Topics include: • Metadata • Rights Management • Electronic Lab Notebooks • PID Systems • Research Software Engineering RDA 14th Plenary Meeting – RDARI IG
Ludwig-Maximilians-UniversitätMünchen (LMU Munich)University Library & RDM Services for the Humanities • LMU Center for Digital Humanities (ITG) is the primary contact for researchers in the Humanities and guides them through the research and development process • University Library (UB LMU) hosts an institutional data repository “Open Data LMU” (using EPrints) and provides infrastructure and library expertise for RDM • ITG and UB LMU are partners in the regional RDM project “eHumanities – interdisziplinär” (together with University Library of Erlangen-Nuremberg), funded by Bavarian State Ministry of Sciences, Research and the Arts RDA 14th Plenary Meeting – RDARI IG
LMU RDM Services – New tools and platforms for a better RDM • Transition to Fedora Repository (plannedfor 2020) • Useof Apache CAMEL • Project Blacklightasdiscoverytool • DataCite Metadata-Generator • Working withsimilartechnologies? Get in touch: fdm-bayern@lmu.de RDA 14th Plenary Meeting – RDARI IG
LMU RDM Services – New methods for a better RDM • Domain-specificindexing (primarilyfortheHumanities) • Mapping DataCite/XML to RDF • Mapping DataCite toDCATfororganizingdata • Defininggranularityforusageof PIDs • Working on optimal linkingbetween different PID systems (ORCID, ROR, etc.) • UB LMU became a DataCite membertoparticipate in communityandexplorefutureusageof DataCite • Dealingwithsimilartopics? Get in touch: fdm-bayern@lmu.de RDA 14th Plenary Meeting – RDARI IG
Technical University of Munich (TUM)University Library & RDM System eric@ub.tum.de • Large university library (~2 million records) Archival of scientific output & research data • RDM project “eRIC” includes software development and consulting: • Guidelines: “customized, open-source, scalable, sustainable” • mediaTUM • (repository) • Workbench • (virtualresearchenvironment) • Consulting, • dissemination, • co-development • RDM • lifecycle • support RDA 14th Plenary Meeting – RDARI IG
TUM RDM Services – eric@ub.tum.de • Long-term preservationand– ifdesired – publicationofdata(uptoseveral TB) • Publication: • (versioned) DOI andpermalinks • Data access via rsync/ftp • Access rightsmanagementallowsforanonymous peer-review https://github.com/mediatum/ RDA 14th Plenary Meeting – RDARI IG
TUM RDM Services – Workbench eric@ub.tum.de • Web platformforresearchandprojectmanagement • Includes electronic labnotebook, fileandtaskmanagement, devicebookings etc. • Automaticchangetrackingandversioning • Collaborationanddetailedprivilegecontrol RDA 14th Plenary Meeting – RDARI IG
LRZ-RDM and National Research Data Infrastructure (NFDI) consortia Internet Having their catalogue integrated in • GeRDI, • EUDAT, • … OAI-PMH server for metadata catalogue • Help with server set-up, automatisation General purpose metadata catalogue • Best-practice use of DataCite standard • Fulfilling requirements for DOI xperience fromGeRDI@LRZ / LRZ-RDM LRZ supports scientists with Community repositoriesof NFDIs (Astro, Neuro, …), datastores at LRZ RDA 14th Plenary Meeting – RDARI IG
LRZ and „specialcategoriesof personal data“ • GDPR „special categories of personal data“ (Art. 9 generally prohibits processing) • Genetic and biometric data • Data concerning health • (…) Data can be processed when consent is given with respect to a particular purpose/usage. • LRZ is building capacity in this area • IT-Lawyer hired (as a researcher) • Evaluation of collaboration modes • Data Processing agreements • Shared-responsibility agreements • … • Evaluation of technical implementation – for now, mostly separate bare-metal systems RDA 14th Plenary Meeting – RDARI IG
LRZ: initial data-handling in pilotbiomedicalresearchprojects BavarianGenomes • Lighthouseprojectfocusing on P4 medicineLead: German Heart CentreMunich • Collects data of patients diagnosed with atherosclerotic diseases (coronary heart disease, stroke or genetic risk factors) and enriches the dataset with state-of-the-art multidimensional molecular characterization (omics technologies) of the respective samples • Safe & securedatahandling,considering legal andethicalaspects • Statistical analysis (forpredicting disease risks, targeted prevention, diagnosis and treatment). • Collection ofpseudonymisedgenomeandphenomedata • Sequencing • Correlationtopseudonymiseddiseasedata, statisticalanalysis Challenge Data arebroughttousforefficientcomputationandintegration, but ourcurrentsystemsare not suitablefor such sensitive data. New specificallydesignedsystemshavetobeemployed RDA 14th Plenary Meeting – RDARI IG
1strdmuc Output: DataCite Best Practice Guide • Authors: ITG, LRZ, UB LMU • Mission: Promote consistentuseofDataCite in participatinginstitutions • Content: • In accordancewith DataCite Metadata Schema 4.3 • Best Practice Examples • Guide will bepublished on GitHub, supplementarypublication will follow RDA 14th Plenary Meeting – RDARI IG
Summary Contacts:LRZ RDM Team:rdm@lists.lrz.de UB TUM RDM Team: eric@ub.tum.de LMU RDM Team: fdm-bayern@lmu.de BSB:Arnost.Stanzel@bsb-muenchen.de Group has a name: rdmuc, and a new participant (BSB) Update on activities from the last year UB TUM: general-purpose RDM / repository + virtual research environment UB LMU & ITG: general-purpose RDM / repository + extended tools for Digital Humanities LRZ: RDM services adjunct to storage solutions + high-throughput/high-volume specialization BSB: OstData – Research Data Service for East- and Southeast European Studies In biomedical research collaborations, LRZ is gaining initial experience with legal and IT-system aspects of eHealth projects First rdmuc output: DataCite best practice guide RDA 14th Plenary Meeting – RDARI IG