Download
slide1 n.
Skip this Video
Loading SlideShow in 5 Seconds..
Teori Kepribadian ( Alfred Adler ) PowerPoint Presentation
Download Presentation
Teori Kepribadian ( Alfred Adler )

Teori Kepribadian ( Alfred Adler )

3791 Views Download Presentation
Download Presentation

Teori Kepribadian ( Alfred Adler )

- - - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript

  1. Teori Kepribadian(Alfred Adler)

  2. Kepribadian • Definisi : • Pencariandanperjuanganuntukmencapaisuperioritas. • Kesadaransebagaipusatkepribadian. • Manusiaadalahmahluk individual. • Manusiaadalahmahluk yang sadarakankekurangandantujuan yang ingindicapainya. • Manusiadidasarioleh motif-motif utamanya, yaitudorongan-dorongansosial.

  3. DimensiTeoriKepribadian Struktur Perubahan Tingkahlaku Proses Kepribadian Psikopatologi Pertumbuhan & Perkembangan

  4. Struktur • Perasaan rendah diri dan kompensasi (Inferiority feeling and compensation) • Tujuan yang semu (Fictional finalism) • Berjuang untuk menjadi superior (Striving for superiority) • Minat sosial (Social Interest) • Gaya hidup (Style of life) • Aku yang kreatif (Creative self )

  5. Proses • Perasaan rendah diri dan kompensasi (Inferiority feeling and compensation) • Semua individu memiliki kekurangan / kelemahan, dan hal itu seringkali memicu perasaan rendah diri. • Untuk menutupi kekurangannya tersebut, individu berusaha untuk mengkompensasi dalam bidang lain.

  6. Proses • Tujuan yang semu (Fictional finalism) • Padadasarnyaindividumelakukansesuatuadalahkarenaadanyatujuankemasadepanbukanmasalalu. • Tujuanitubersifatsemu, tetapidapatmenjadipendorongbagiindividudalammelakukansesuatu.

  7. Proses • Berjuanguntukmenjadi superior (Striving for superiority) • Setiapindividuselaluinginmenjadi yang sempurna / mengejarkesempurnaan. • Superioritasmerupakansuatugerak yang mengarahkanindividupadakesuksesanterutamadalamkontekssosial.

  8. Proses • Minatsosial (Social Interest) • Minat-minatsosialmencakupkerjasama, relasi interpersonal dansosial, identifikasikelompok, empati. • Individudikatakansehatapabilatermotivasiolehperasaan inferiority yang normal disertaidenganminatsosial yang tinggi.

  9. Proses • Gaya hidup (Style of life) • Merupakancara yang unikdarisetiapindividu yang berjuanguntukmencapaitujuan . • Setiapindividumemilikigayahidup, tetapitidakadaduaorang yang mengembangkangayahidupygsama.

  10. Proses • Aku yang kreatif (Creative self ) • Individumenciptakankepribadiannyasendiridenganmengkonstruksisifat-sifataslinyadenganpengalaman yang diperoleh. • Individumemilikikekuatanuntukbebasmenciptakangayahidupnyasendiri-sendiri.

  11. Pertumbuhan & Perkembangan • Kepribadianseorangindividumulaiterbentukdancenderungmenetapsejakusia 5-6 tahun • 3 pengaruhmasakanak-kanak yang menetapdalamsuatugayahidup yang salah : • Perasaanrendahdiri ( feeling of inferiority ) • Pemanjaan ( pampering ) • Pengabaian ( neglectful ) • Adler mengembangkanteoriurutanlahir, didasarkanpadakeyakinanbahwaketurunan, lingkungan, dankreatifitaslingkunganbergabungmembentukkepribadian.

  12. Pertumbuhan & Perkembangan Perbedaansifatanaksesuaidenganurutankelahiran : • Anakpertama : menjaga, melindungi, pengatur yang baik, kecemasantinggi, pengkritik • Anakkedua : motivasinyatinggi, sukabersaing, dapatbekerjasama, pemberontak, mudahputusasa. • Anakbungsu : ambisius, realistis, manja, tergantungpadaorang lain • Anaktunggal : dewasasecarasosial, manja, inginselalumenjadipusatperhatian, perasaankerjasamarendah, takutbersaing.

  13. Psikopatologi Psikopatologi merupakan akibat dari kurangnya keberanian, perasaan inferior yang berlebihan, dan minat sosial yang kurang berkembang. Akibatnya : • Neurosis • Narkoba • Kenakalan remaja • Tindak kriminal • Bunuh diri • Prostitusi

  14. Psikopatologi Gangguan tersebut ditandai dengan : • Memasang tujuan hidup yang terlalu tinggi • Hidup didunianya sendiri • Gaya hidup yang kaku dan dogmatis • Tidak berkembangnya social interest secara maksimal. Tujuan utama psikoterapi untuk meningkatkan keberanian, mengurangi perasaan inferior, dan mendorong berkembangnya minat sosial.

  15. Perubahan Tingkah Laku • Individu dapat berubah karena adanya dorongan untuk mencapai tujuan / superiority. Contohnya : Ketika kita mengetahui bahwa ada surga dan neraka, kita akan termotivasi untuk melakukan hal yang baik dengan tujuan kita dapat masuk ke surga.

  16. PerubahanTingkahLaku • Terkadangindividutidakmampuberubah, karenakebiasaanmemandangsegalasesuatudarisuduttertentu yang bersifatbeku, danmenganggapnyasebagaihukumalam, menekankebebasanbatindanmendorongkearahketidakberanian. Contohnya : Denganmengatakanbahwa “ akutidak mampu “.