Download
masalah dan potensi masalah pada pemilu 2014 n.
Skip this Video
Loading SlideShow in 5 Seconds..
Masalah dan Potensi Masalah Pada Pemilu 2014 PowerPoint Presentation
Download Presentation
Masalah dan Potensi Masalah Pada Pemilu 2014

Masalah dan Potensi Masalah Pada Pemilu 2014

250 Vues Download Presentation
Télécharger la présentation

Masalah dan Potensi Masalah Pada Pemilu 2014

- - - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript

  1. Masalahdan Potensi Masalah Pada Pemilu 2014 Oleh Arief Budiman (Komisioner KPU RI)

  2. TAHAPAN, PROGRAM DAN JADWAL PEMILU 2014

  3. TAHAPAN PEMILU YANG SUDAH TUNTAS Perencanaan program, anggarandanPenyusunanperaturan PendaftarandanverifikasipesertaPemilu PenetapanpesertaPemilu Tahapan Yang SudahTuntas Penetapanjumlahkursidandaerahpemilihan Pencalonananggota DPR, DPD, DPRD Provinsidan DPRD Kabupaten/Kota Pemutakhiran data pemilihdanpenyusunandaftarpemilih

  4. TAHAPAN YANG SEDANG DAN AKAN BERJALAN Tahapan Yang SedangBerjalan Pelaksanaankampanye Masatenang Pemungutandanpenghitungansuara Tahapan Yang AkanBerjalan PenetapanHasilPemilu Pengucapansumpah/janjianggota DPR, DPD dan DPRD

  5. MasalahPadaTahapanPemilu TahapPendaftarandanVerifikasiParpol PartaipolitiktidaksepenuhnyadapatmengoperasionalkanSipol Putusan MK Nomor 52/PUU-X/2012 yang mewajibkansemuaparpolcalonpesertaPemiluwajibmengikutiverifikasi ParpolcalonpesertaPemilusebagianbesarmenyerahkanpersyaratanmenjelangbatasakhirpendaftaran KPU butuhwaktu yang lebihpanjanguntukmencermati data-data parpolkarena data yang diserahkanparpoldalambentuk manual Putusan DKPP No.23-25/DKPP-PKE-I/2012 yang memerintahkan KPU melakukanverifikasifaktualterhadap 18 parpol yang tidaklolosverifikasiadministrasi KPU membutuhkantambahananggaranuntukmelakukanverifikasifaktual 18 parpol yang dinyatakantidaklolosverifikasiadministrasi Kebijakanafirmatif action 30 persenperempuandalamkepengurusanparpoltingkatpusat, provinsidankabupaten/kotadiprotesparpol

  6. MasalahPadaTahapanPemilu Kebijakan KPU untukPenanganannya PerpanjanganmasapendaftaranpartaipolitikcalonpesertaPemilu 2014 PerpanjanganwaktuverifikasiadministrasipartaipolitikcalonpesertaPemiludengancaramengubahperaturantentangtahapan, program danjadwal Mengorganisirkelompokkerja (Pokja) verifikasiuntukkembalimelakukanverifikasifaktualterhadap 18 parpoldisetiapjenjang Memaksimalkansisaanggaranverifikasifaktual 16 parpol Memintabantuanpemerintahuntukmemfasilitasipelaksanaanverifikasifaktual 18 parpol yang dinyatakantidaklolosverifikasiadministrasi PlenoterbukapenetapanparpolpesertaPemilusecaraberjenjang Memberikankesempatankepadaparpoluntukadu data terhadaphal-hal yang dianggaptidakmemenuhisyarat (TMS)

  7. MasalahPadaTahapanPemilu TahapPenataan Daerah PemilihandanAlokasiKursi Pembentukandaerahotonomibaru (DOB) olehpemerintahsebelumpelaksanaanPemilu Terdapatkabupaten/kota yang tidakbisadijadikansatudaerahpemilihankarenakonversijumlahpendudukdengankursikurangdari 3 kursi Penyebaranpenduduk yang tidakmeratadisejumlahdaerahsehinggamengakibatkanterdapatdapildengangeografis yang sangatluastetapijumlahkursinyasedikit Tuntutandibeberapadaerahuntukmemperhatikanrepresentasisuku, budayadankedekatansecarageografisdalampembentukandapil Perbedaan DAK2 milikKemendagridenganPemerintah Daerah

  8. MasalahPadaTahapanPemilu Kebijakan KPU untukPenanganannya PenataanDapildilakukandenganmemperhatikanbatas-bataswilayahdaerahindukdengan DOB Alokasikursidandapiluntuk DOB ditatasetelahpelaksanaanPemilu KPU menggunakan DAK2 Kemendagriuntukmenetapkandapildanmelakukankomunikasipersuasifkepadadaerah yang menilai DAK2 Kemendgaribermasalah KPU menggelarkonsultasipublikdalampenataandapildisetiaptingkatanuntukmenyerapaspirasimasyarakatdanmemastikandapilbenar-benarrepresentatif KPU konsistendenganrumusanpenataandapilyaknikesetaraannilaisuara, ketaatanpadasistempemiluproporsional, proporsionalitas, integritaswilayah, coterminous, kohesivitasdankesinambungan Daerah dengankonversijumlahpendudukmenjadikursikurangdari 3, dapilnyadigabungdengandaerah lain

  9. MasalahPadaTahapanPemilu TahapPencalonanAnggota DPR, DPD dan DPRD Kurangnyapemahamancalegterhadapkelengkapanpersyaratanadministrasipencalonan Informasitentangpemenuhankelengkapanpersyaratancalondaripengubungparpolkurangmaksimalkepadaparasetiapcaleg Beberapacalegterkendaladengan KTP sebagaisyaratpencalonankarenapencetakan e-KTP belumrampung, sementara KTP lama sudahditarik Sejumlahbacalegpencalonannyaganda/terindikasigandabaikgandadidaerahpemilihan (dapil) maupungandaparpol Partaipolitikmenggugatkeputusan KPU tentangpenetapan DCS yang mencoret lima parpoldi 8 dapilkarenatidakmemenuhikuota 30 persenperempuan Putusan MK Nomor 39/PUU-XI/2013 yang membatalkanpasal 16 ayat 3 UU Nomor 2 Tahun 2011 tentangkewajibanmengundurkandiribagianggota DPRD dariparpol yang gagalmenjadipesertaPemilu yang akanmajulagimenjadicalegdariparpolpesertaPemilu

  10. MasalahPadaTahapanPemilu Kebijakan KPU UntukPenanganannya Mengoptimalkanperan help desk untukmemberikanlayananinformasidankonsultasikepadaparpol Mendorongparpoluntukmengoptimalkanfungsipenghubungdalammenyampaikansegalainformasikepadaparpoldanparacaleg Untukpersoalan KTP, paracalegdapatmemintasuratketerangandariaparaturpemerintahansetempat Mengembalikancaleggandadanterindikasigandakepadaparpoluntukdiperbaiki KPU melakukanperubahankeputusantentangpenetapan DCS berdasarkanrekomendasiBawaslu KPU RI mengeluarkansuratedarannomor 554/KPU/VIII/2013 tentangPenjelasanTerkaitPutusan MK Nomor 39/PUU-XI/2013

  11. MasalahPadaTahapanPemilu TahapPemutakhiran Data PemilihdanPenyusunanDaftarPemilih Dari 190.463.184 DP4 yang diserahkanpemerintah, hanya175.142.000 data merupakan yang hasil perekaman KTP elektronik Dari 175.142.000 DP4hasilperekaman KTP elektronik, baru 148 juta e-KTP yang tercetak Dari 190.463.184 DP4, sebanyak 1,8 juta DP4 terdeteksiganda, 65 jutatanpa NIK, 40 jutatidakmemilikiketerangan RT dan 50 jutatidakmemilikiketerangan RW, 77 ribupemilihbelumberumur 17 tahun, dan 3228 NIK sama Pencairan honor Pantarlih, PPS dan PPK terlambatsehinggamengakibatkanpengumpulan data daribawahjugamenjaditerhambat DPS minim masukandantanggapandarimasyarakatdanparpol Kondisigeografisdisejumlahdaerahsulitsehinggapengiriman data dari PPS keKabupaten/Kota terlambat Jaringan internet disejumlahdaerahseringbermasalahsehinggapengiriman data daridaerahkepusatterhambat

  12. MasalahPadaTahapanPemilu Kebijakan KPU UntukPenanganannya KPU menggunakanSidalihuntukkonsolidasidandistribusi data Pemilih KPU secarasistemikmenghapus data ganda K1 danmelakukanverifikasifaktualkembaliterhadap data ganda K2 Mengumumkan DPS, DPSHP, DPSHPA dan DPT secara manual dan online untukmempermudahmasyarakatmengaksesnya Memperpanjangmasapengumumandantanggapanmasyarakatterhadap DPSHP Menggelarplenoterbukapenetapan DPT secaraberjenjang Melakukanpenyandingan data DPSHP dan DPT dengan DP4 milikKemendagri MenindaklanjutirekomendasiBawasluuntukmenundapenetapan DPT danmencermatiulang DPT yang sudahditetapkan Konsolidasi operator Sidalihseluruh Indonesia mulaitingkatkabupaten/kotadiprovinsidantingkatprovinsidipusatuntukmerapikan DPT Verifikasiulangkelapanganterhadap DPT dengan NIK invalid untukmemastikankeberadaanorangnya Membahasprogresperbaikan DPT bersamaKemendagri, Bawaslu, utusanParpol, DKPP, danKomisi II

  13. PotensiMasalahPadaTahapanPemilu PotensiMasalahpadaTahapKampanye Pemanfaatanjabatanolehparapolitisiuntukmengkampanyekandirinyakepadapubliklewatiklanlayananmasyarakat (ILM) Penggunaan media massauntukkegiatankampanyesecaraterselubungdanberlebihanolehparapemilik media yang jugaberstatussebagaipolitisidiluarjadwal yang diperbolehkan Penggunaan media sosialanonimuntukmenyerangdanmelakukankampanyehitamantarpesertaPemiludankandidat Pengumpulansumbangandanakampanyemelebihibatasmaksimal yang sudahditentukan Pemanfaatanjabatanolehparapolitisiuntukmengkonsolidasikankegiatan-kegiatansosialmenjelangpelaksanaanPemilu 2014 Politikuangdengan motif kegiatansosialolehpesertaPemiluterutamadisegmenmasyarakat yang rentan Menggunakanfasilitaspemerintah, tempatibadahdantempatpendidikanuntukkegiatankampanyeterselubung Diskriminasidalampenggunaanfasilitasumumuntukkegiatankampanyeparpoldancalegtertentu

  14. PotensiMasalahPadaTahapanPemilu Kebijakan KPU UntukAntisipasinya Laranganpejabatnegara, pimpinandananggota DPRD yang menjadicalonanggota DPR, DPD dan DPRD menjadipemeraniklanlayananmasyarakatpadainstitusinya Pengaturanpemasanganbaliho, billboard danspandukuntuksetiapparpoldancaleg Pelaporandanakampanyeparpolsecaraberkalake KPU yang didalamnyaterdapatlaporandanakampanyecaleg Penetapanzonadan media pemasanganalatperagakampanyebekerjasamadenganPemerintah Daerah Pengaturanzonadanjadwalkampanyeuntuksetiapparpol KPU, Bawasludan KPI membentuk Task Force dengantugasmelakukanpengawasandananalisaiklankampanyeuntukmenyamakansikapdanpersepsi Mendorong KPI danDewanPersmemberikansanksi yang tegasterhadap media yang melanggarpemuatanberita, siarandaniklankampanye

  15. PotensiMasalahPadaTahapanPemilu TahapPemungutan, PenghitungandanRekapitulasiSuara Intimidasi, suapdankekerasanterhadappenyelenggara, saksidanpemilih Penggelembungansuara Manipulasisuaradenganmenukarformulir C1 Pemalsuanidentitas Mencoblossuratsuarasisa Mencobloslebihdarisatu kali Menghalang-halangipengawasdansaksiuntukmendapatkanformulir C1

  16. PotensiMasalahPadaTahapanPemilu Kebijakan KPU UntukAntisipasinya • Penandaankhususuntukformulir C1 dan C1 plano Mengunggahhasilpemindaianrekapperolehansuaradi TPS (formulir C1) ke server KPU Pengunggahanformulir C1 ditingkatkabupaten/kotadilakukantanpamenunggurekapdi PPS dan PPK Petugas PPS dan PPK jugawajibmengunggahhasilrekapitulasidi PPS dan PPK ke server KPU Formulir C1 planowajibdibukasaatrekapitulasidi PPS Memperbolehkanmasyarakatuntukmendokumentasikanhasilperolehansuara Kegiatanpenghitungandanrekapitulasisuaradilakukanditempatterbuka

  17. Penutup TerimaKasih