330 likes | 462 Vues
ShewCyc and BeoCyc : discovery platforms for environmental and bioenergy research. Tatiana Karpinets, Gretta Serres , and Michael Leuze Oak Ridge National Lab, Marine Biological Laboratory. Pathway Tools Workshop 2010. ShewCyc and Shewanella Knowledgebase.
E N D
ShewCycand BeoCyc: discovery platforms for environmental and bioenergy research Tatiana Karpinets, GrettaSerres, and Michael Leuze Oak Ridge National Lab, Marine Biological Laboratory Pathway Tools Workshop 2010
ShewCycand Shewanella Knowledgebase http://shewanella-knowledgebase.org:8080/Shewanella/
Manual reannotation • Localization prediction • Regulon predictions (http://regprecise.lbl.gov/RegPrecise/) • Capture information from literature, gene expression data, proteomics
Crp Fur ArgR Fnr
ShewanellaoneidensisMetabolic Pathway Viewer developed by Erich Baker , Baylor University, TX http://watson.ecs.baylor.edu/4360/
Multi-Genome Annotation Solution:Ortholog Editor in Combination with Genome Editors Manual Curation Improved Individual Genome Editors
Ortholog Table Tools Sort Search Table Overview Edit View Evidence View Alignments View Consistency Check View Download
Alignment View MUSCLE (3.6) multiple sequence alignment Sfri_3956 MKIRVLISLATAFFMLNTSSAFAKDPADTAVQPLLVKPKVIIFDVNETLLDLENMRASVG Swoo_1992 ---------------------MTLELRDTSIIKDF--PKAVIFDTDNTLYPYHYSHQQAS :: : **:: : **.:***.::** . ... Sfri_3956 KALNGREDLLPLWFSTMLHHSLVVSATGDYQTFGSIGVA---------SLQMVAEINGIA Swoo_1992 LAVQQKAEKILGIKQSRFSDALKISKREIKERLGETASSHSRLLYFQRTIELLGLKTQIM *:: . : : .: : :* :* : :*. . : :::::. . * Sfri_3956 ITPEQAKTAILTPLRSLPAHPDVAEGLAKLKAQGYKLVTLTNSSLEGVTLQLKNANLSQY Swoo_1992 TTLDLEQTYWRTFLTNSQLFPEMHEFLHDLRAHGIQSAVVTDLTAQIQFRKLVYFGLHEA * : :* * * . .*:: * * .*.*:* : ..:*: : : :* .* : Sfri_3956 FDANLSIESVGVFKPHLKTYQWAIKDLGVNADEAL-MVAAHGW-DIAGADKAGLQTAFIR Swoo_1992 FDYIVTTEEAGADKPNPLPFQLARSKLGLEKGDNLWMIGDHPVKDIQGAKKT-LGAITLQ ** :: *..*. **: .:* * ..**:: .: * *:. * ** **.*: * : :. Sfri_3956 RQGKVLFPLAAQPDYNVL--DVNELASTLAKFN----- Swoo_1992 KNHKDVKVLKGKEGPDILFDKYSELRELLGEISSNKGK .: * : * .: . ::* . .** . *.::.
Consistency Check View Group annotation Protein length consistency Original annotations Domain consistency Automatic identification of bad grouping • Protein Length Consistency • Domain Consistency
Probing Intergenic Regions (IGs) in S. oneidensisusing microarray Experimental data (Many Microbe Microarrays Database): CRP mutant vs wild type MR1 (various time points during the transition from aerobic growth with lactate to anaerobic growth with lactate and fumarate. Affymetrix microarray was designed to probe transcripts derived from both genes and IGs Examples: IG SO0016_SO0022; IG SO0017-SO0015
A regulatory effect of the IG transcription Down-stream gene IG Up-stream gene Subset I: IG regions with the same direction of change in gene expression as their neighboring genes (1466) Subset A: IG regions with directions of changes in gene expression that are opposite to upstream genes (805) Subset B: IG regions with directions of changes in gene expression that are opposite to downstream genes (820)
Revealing a biological role of Intergenic Regions transcription using Pathway Tools IG (SO2490_SO2491) SO2490 (HexR) Enzymes of the Entner–Doudoroff(ED) pathway SO2491 (PykA) HexR PykA
BioEnergy research Science Center(BESC) Breakdowninto sugars Fuel(s) Sugar Fermentation Cellulosic biomass BESC’s approach: • designing plant cell walls for rapid deconstruction and • engineering microbes for converting plants into biofuel in a single step (consolidated bioprocessing)
BESC knowledgebase: a discovery platform for bioenergy research Manually curated (NREL, UGA) pathway genome database for Populustrichocarpa Usage Summary http://besckb.ornl.gov • Genomes comparison, analysis and visualization tools: • Genome browsers • Comparative chromosome maps (CMAP) • Metabolic maps • Omic Viewers • and more Metabolic reconstructions for BESC relevant microorganisms (BeoCyc) Integrating Experimental Data from LIMS and external resources: Microbial Phenotypes comparison toolkit • Computational predictions: • Orthologs/Inparalogs • Protein Domains • Protein Localization • Metabolic enzymes and pathways • Carbohydrates Active Enzymes • and more Analysis Framework
CAZYmes Analysis Toolkit (CAT) Novel approach based on the association analysis to discover links between CAZy families and pfam domains Web site: http://cricket.ornl.gov/cgi-bin/cat.cgi Find conserved associations between CAZy families and pfam domains Assign carbohydrates activity to unknown protein domains Find CAZymes among hypothetical proteins Assign CAZy families to a sequence with high specificity and sensitivity Suggest novel CAZy families
Private BeoCychosts a • P. trichocarpa PGDB manually curated by NREL team GDP-mannose biosynthesis II, GDP-L-fucose biosynthesis I (from GDP-D-mannose), GDP-L-fucose biosynthesis II (from L-fucose), UDP-D-galactose biosynthesis, UDP-D-galacturonate biosynthesis I (from UDP-D-glucuronate), UDP-D-galacturonate biosynthesis II (from D-galacturonate), UDP-D-glucose biosynthesis (from sucrose), UDP-D-glucuronate biosynthesis (from myo-inositol), UDP-D-xylose biosynthesis (compartmentalized), UDP-L-arabinose biosynthesis I (from UDP-xylose) in Endoplasmic Reticulum, UDP-L-arabinose biosynthesis I (from UDP-xylose) in Cytosol, UDP-L-arabinose biosynthesis I (from UDP-xylose) in Golgi lumen, UDP-L-arabinose biosynthesis II (from L-arabinose) in Cytosol
BeoCyc and BESC knowledgebase http://bobcat.ornl.gov/besc/index.jsp
Arabidopsis Populus EC numbers EC numbers Genes Genes Blast Ortholog search Sequences Sequences Kyoto Encyclopedia of Genes and Genomes genomic and molecular information Improving PopulusTrichocarpa genome annotation • Poor annotation of the poplar genome (gene models and predicted enzymes) • Poor representation of the cell wall biosynthesis and related pathways in the reference databases (MetaCyc, KEGG, and PlantCyc) Future!!! RESD & PESD
Refine the PGDBs RefSeq files from the NCBI Create MySQL tables Pathway Genome Databases Supplement databases by additional annotations Input files for Pathologic Enzyme information KEGG, CAZy Compare phenotypes of the organisms In terms of their genomic and metabolic characteristics Integration of the metabolic reconstructions into BESC knowledgebase
Arabidopsis Populus EC numbers EC numbers Genes Genes Ortholog search Sequences Sequences Challenge : automatic PGDB generation for draft genomes using one table for orf predictions fastAcontigs !!! Predict automatically TU, complexes, transporters for each contig >C0 ATAAAGACGAAAAGCACCGGATCGAACACCGCCACTTCGAAAACTTCGAACGTCTACGG …. >C1r AGTGCGGCTAGGCCGTCGATGGAGCTAGGCCGTCGA …. >C3r GACGAAAAGCAGACGAAAAGCAGACGAAAAGCAGCT…. ….
Involvement of Single-Genotype Consortia in Degradation of Aromatic Compounds by Rhodopseudomonaspalustris p-Coumarate - - anoxygenic photosynthesis Benzoate - aerobic or anaerobic respiration and fermentation - fixation of nitrogen gas - utilization of carbon through CO2 reduction using H2 as an electron donor
Average log2 ratio of the expression of nitrogenases with different cofactors in the growth on p-coumarate and benzoate versus succinate • Transpoters • Chemotaxesoperons • Curli formation operon
Expression of R. palustrisphenotypes under p-coumarate (black columns) and benzoate (white columns) degrading conditions if compared with growth on succinate. p-Coumarate - Benzoate
Structures of R. palustris consortia mediating anaerobic growth on p-coumarate (A) and on benzoate (B)
Putative electron donor and electron acceptor reactions under different modes of the Rhodopseudomonaspalustrisgrowth
Changes in total nitrogen, ammonium and dissolved nitrogen gas during the benzoate degradation as functions of OD660
Acknowledgements ShewCyc and Shewanella Knowledgebase PNNL: Margaret Romine Marine Biological Laboratory: Margrethe Serres ORNL: Denise Schmoyer Guruprasad Kora Mustafa Syed Erich Baker Hoony Park Nagiza Samatova and Edward Uberbacher BeoCyc and BESC Knowledgebase NREL: Ambarish Nag Christopher Chang UGA: Maor Bar-Peled ORNL: Mustafa Syed Hoony Park Morrey Parang Denise Schmoyer and Edward C. Uberbacher