1 / 44

Building CryptoDB: A Genomic Data Warehouse at UGA for Tropical and Emerging Diseases

The University of Georgia's Mark Heiges Center is developing CryptoDB, a genomic data warehouse designed to analyze and visualize genomic sequences and gene annotations for tropical and emerging global diseases. Utilizing GUS (Genomic Unified Schema) and web development tools, CryptoDB aims to load and manage data from external resources like NCBI and NRDB, facilitating complex analyses using plugins. This project focuses on meeting the research community's needs by integrating diverse data types and ensuring data accessibility and visualization through a user-friendly interface.

connie
Télécharger la présentation

Building CryptoDB: A Genomic Data Warehouse at UGA for Tropical and Emerging Diseases

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. Building CryptoDB using GUS Mark Heiges Center for Tropical and Emerging Global Diseases University of Georgia mheiges@uga.edu

  2. Genomic Data Analysis Results GUS Plugins Tomcat WDK Apache

  3. External Resources: • NCBI Taxonomy (SRes) • SO (SRes) • NRDB (DoTS) • Our data (DoTS) Plugins Web Development Kit GUS helper script • Analysis Input: • contigs • proteins • NRDB Plugins Analysis Results

  4. Site Design Considerations • data types we wanted to warehouse • additional analyses desired • how to load data into GUS • how to visualize data • tables • text • graphics (interactive, static) • what types of questions will be asked of the data

  5. Deciding Factors • What data was available. • What the research community needed. • What we could accomplish by the contractual deadline for our first release.

  6. Crypto External Resource Data • Genomic sequence and gene annotations for two species (GenBank) • sequence • CDS translations • gene product descriptions • exon coordinates • RNA type (mRNA, tRNA, snoRNA, rRNA) • other features • EST/mRNA (GenBank)

  7. Auxillary Data Required • NRDB • NCBI Taxonomy Reference • Sequence Ontology Definitions

  8. External Resources: • NCBI Taxonomy (SRes) • SO (SRes) • NRDB (DoTS) • Our data (DoTS) Plugins Web Development Kit GUS helper scripts • Analysis Input: • contigs • proteins • NRDB Plugins Analysis Results

  9. GUS Plugins • Perl modules for loading data into GUS • facilities to connect to the GUS perl object layer and the database • process command line arguments • create tracking information in the database • log and handle errors

  10. GUS Plugins • Supported and Community plugins bundled with GUS • Plugins are versioned • Each plugin version must be registered with GUS before use • records cvs version and md5 checksum • auditing

  11. Data Loading at CryptoDB • Install GUS • Register selected plugins • Load Controlled Vocabularies • NCBI Taxonomy • Sequence Ontology Definitions • Load Crypto annotated sequences from GenBank records • Load NRDB from FASTA file

  12. Data Loading at CryptoDB • Load Crypto mRNA GenBank records • Load ESTs from U Penn's database of NCBI's dbEST

  13. CryptoDB Analyses • BLASTP - compare annotated proteins to nrdb • BLASTX - compare whole genome to nrdb • BLASTN - synteny comparison of the two Crypto species we host • EST/mRNA clustering and alignment • signal peptide predictions • transmembrane predictions

  14. Analysis Workflow • Load Source Data into GUS (NRDB, genomic seqs) • Dump same data from GUS with GUS Ids • Perform analysis with this data (BLASTX) • Load results into GUS • GUS Ids allow results to be linked back to analysis input data

  15. External Resources: • NCBI Taxonomy (SRes) • SO (SRes) • NRDB (DoTS) • Our data (DoTS) Plugins Web Development Kit GUS helper script • Analysis Input: • contigs • proteins • NRDB Plugins Analysis Analysis Results

  16. Data Analysis - BLASTP • Dump NRDB records from GUS to FASTA file - with GUS Ids >336 source_id=0703290B secondary_identifier=223280 tubulin alpha length=411 TIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAA NNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVD YGKKSKLEFSIYPARQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIE RQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIE • Dump annotated protein sequences from GUS to FASTA file - with GUS Ids

  17. External Resources: • NCBI Taxonomy (SRes) • SO (SRes) • NRDB (DoTS) • Our data (DoTS) Plugins Web Development Kit GUS helper scripts • Analysis Input: • contigs • proteins • NRDB Plugins Analysis Analysis Results

  18. Data Analysis - BLASTP • Run BLASTP algorithm with these two GUS Id labeled datasets • used a Perl wrapper to BLAST executable, included with GUS... plugin compatible output • Load BLAST results with plugin • ga GUS::Common::Plugin::LoadBlastSimFast --file blastSimilarity.out --restartAlgInvs "" --queryTable DoTS::ExternalNASequence --subjectTable DoTS::ExternalAASequence --commit

  19. Post Data Loading • Find where the results were loaded • read documentation • ga GUS::Common::LoadBLAST --help • looked in plugin source code • asked other users • gusdb.org schema browser • fishing expeditions in GUS tables

  20. Getting Our Database On Line

  21. External Resources: • NCBI Taxonomy (SRes) • SO (SRes) • NRDB (DoTS) • Our data (DoTS) Plugins Web Development Kit GUS helper scripts • Analysis Input: • contigs • proteins • NRDB Plugins Analysis Results

  22. Web Development Kit (WDK) • provides accelerated development of database driven web sites • define questions and records in model XML file • default JavaServer Pages (JSP) views provided • not specific to GUS • can be used with any RDBMS

  23. WDK Question - Summary - Record Paradigm • Users supply parameter values to a canned question on the website • "Which genes have at least __ exons?" • The result is returned in summary pages that list links to the record pages • Record page - detailed view of data object • text • graphics • tables

  24. Questions Summary Record

  25. WDK Model - View - Controller architecture • Model XML configuration defines • questions • answer summaries • records • View • displays the model • defined in customizable JavaServer pages • Controller • internal, not configurable

  26. WDK Setup • build • write WDK model (WDK comes with Toy site - spent some time with that before hand) • test model from command line • install WDK into Tomcat • customize the view (jsp) pages • integrate Tomcat with Apache - personal preference

  27. WDK Model:Defining Questions <question name="GeneByContig" displayName="Genes by Contig" queryRef="GeneFeatureIds.GeneByContig" summaryAttributesRef="source_id,product,organism,contig" recordClassRef="GeneRecordClasses.GeneRecordClass"> <description>Find gene located on a given contig</description> </question>

  28. <sqlQuery name="GeneByContig" displayName="By Contig" isCacheable='true'> <description> Find Genes By Contig ID. </description> <paramRef ref="params.contig"/> <column name="source_id" isInternal="false"/> <sql> <!-- use CDATA because query includes angle brackets --> <![CDATA[ select g.source_id from dots.genefeature g, dots.naentry nae, dots.sequencetype st, dots.externalNAsequence enas where nae.na_sequence_id = g.na_sequence_id and enas.sequence_type_id = st.sequence_type_id and enas.na_sequence_id = nae.na_sequence_id and st.name = 'contig' and nae.source_id = '$$contig$$' ORDER BY g.source_id ]]> </sql> </sqlQuery>

  29. WDK Model - Record <recordClass idPrefix="" name="GeneRecordClass" type="Gene" attributeOrdering="source_id,exoncount,overview, product,linkout,dnaContext,genomeCompare,tmdata,blastpgraphic, translation,sequence,reference"> <attributeQueryRef ref="GeneAttributes.GeneAttrs"/> <attributeQueryRef ref="GeneAttributes.ExonCount"/> <attributeQueryRef ref="GeneAttributes.TMCount"/> <tableQueryRef ref="GeneTables.BlastP"/> <textAttribute name="overview" displayName="Overview"> <text> <![CDATA[ This <b><i>$$organism$$</i></b> gene spans positions <b>$$start_max$$</b> - <b>$$end_min$$</b> of contig <a href="showRecord.do?id=$$contig$$"><b>$$contig$$</b></a> which maps to chromosome <b>$$chromosome$$</b> ]]> </text> </textAttribute> </recordClass>

  30. Testing the Modelcommand line tools • wdkXml - check xml syntax • wdkSummary - test a summary • wdkQuery - run specific query • wdkRecord - test a record • wdkSanityTest - exercises all queries and records • wdkCache

  31. Install WDK into Tomcat • follow the installation instructions carefully • relies on symbolic links from Tomcat webapp to $GUS_HOME • disallowed by default Tomcat configuration • keep an eye on Tomcat logs for troubleshooting • reload the webapp when model changes • retest on command line • don't forget about the cache

  32. WDK Default View

  33. CryptoDB Custom View • Made style changes, added site branding • Added additional form elements • radio buttons, check boxes • 'Flattened out' the questions

  34. CryptoDB Custom View • Record pages - alterations to acheive the desired ordering and placement of text, tables and graphics • Standard JSP tags to embed external objects • GBrowse graphic

  35. Integrate Tomcat with Apache • Apache front end answers all web requests • Serves the static pages and cgi tools • BLAST interface • motif search • BLASTX keyword search • Calls to the WDK are passed to Tomcat

  36. External Resources: • NCBI Taxonomy (SRes) • SO (SRes) • NRDB (DoTS) • Our data (DoTS) Plugins Web Development Kit GUS helper scripts • Analysis Input: • contigs • proteins • NRDB Plugins Analysis Results

  37. Pipeline • External Resources: • NCBI Taxonomy (SRes) • SO (SRes) • NRDB (DoTS) • Our data (DoTS) Plugins Web Development Kit GUS helper scripts • Analysis Input: • contigs • proteins • NRDB Plugins Analysis Results

More Related