Building CryptoDB: A Genomic Data Warehouse at UGA for Tropical and Emerging Diseases
The University of Georgia's Mark Heiges Center is developing CryptoDB, a genomic data warehouse designed to analyze and visualize genomic sequences and gene annotations for tropical and emerging global diseases. Utilizing GUS (Genomic Unified Schema) and web development tools, CryptoDB aims to load and manage data from external resources like NCBI and NRDB, facilitating complex analyses using plugins. This project focuses on meeting the research community's needs by integrating diverse data types and ensuring data accessibility and visualization through a user-friendly interface.
Building CryptoDB: A Genomic Data Warehouse at UGA for Tropical and Emerging Diseases
E N D
Presentation Transcript
Building CryptoDB using GUS Mark Heiges Center for Tropical and Emerging Global Diseases University of Georgia mheiges@uga.edu
Genomic Data Analysis Results GUS Plugins Tomcat WDK Apache
External Resources: • NCBI Taxonomy (SRes) • SO (SRes) • NRDB (DoTS) • Our data (DoTS) Plugins Web Development Kit GUS helper script • Analysis Input: • contigs • proteins • NRDB Plugins Analysis Results
Site Design Considerations • data types we wanted to warehouse • additional analyses desired • how to load data into GUS • how to visualize data • tables • text • graphics (interactive, static) • what types of questions will be asked of the data
Deciding Factors • What data was available. • What the research community needed. • What we could accomplish by the contractual deadline for our first release.
Crypto External Resource Data • Genomic sequence and gene annotations for two species (GenBank) • sequence • CDS translations • gene product descriptions • exon coordinates • RNA type (mRNA, tRNA, snoRNA, rRNA) • other features • EST/mRNA (GenBank)
Auxillary Data Required • NRDB • NCBI Taxonomy Reference • Sequence Ontology Definitions
External Resources: • NCBI Taxonomy (SRes) • SO (SRes) • NRDB (DoTS) • Our data (DoTS) Plugins Web Development Kit GUS helper scripts • Analysis Input: • contigs • proteins • NRDB Plugins Analysis Results
GUS Plugins • Perl modules for loading data into GUS • facilities to connect to the GUS perl object layer and the database • process command line arguments • create tracking information in the database • log and handle errors
GUS Plugins • Supported and Community plugins bundled with GUS • Plugins are versioned • Each plugin version must be registered with GUS before use • records cvs version and md5 checksum • auditing
Data Loading at CryptoDB • Install GUS • Register selected plugins • Load Controlled Vocabularies • NCBI Taxonomy • Sequence Ontology Definitions • Load Crypto annotated sequences from GenBank records • Load NRDB from FASTA file
Data Loading at CryptoDB • Load Crypto mRNA GenBank records • Load ESTs from U Penn's database of NCBI's dbEST
CryptoDB Analyses • BLASTP - compare annotated proteins to nrdb • BLASTX - compare whole genome to nrdb • BLASTN - synteny comparison of the two Crypto species we host • EST/mRNA clustering and alignment • signal peptide predictions • transmembrane predictions
Analysis Workflow • Load Source Data into GUS (NRDB, genomic seqs) • Dump same data from GUS with GUS Ids • Perform analysis with this data (BLASTX) • Load results into GUS • GUS Ids allow results to be linked back to analysis input data
External Resources: • NCBI Taxonomy (SRes) • SO (SRes) • NRDB (DoTS) • Our data (DoTS) Plugins Web Development Kit GUS helper script • Analysis Input: • contigs • proteins • NRDB Plugins Analysis Analysis Results
Data Analysis - BLASTP • Dump NRDB records from GUS to FASTA file - with GUS Ids >336 source_id=0703290B secondary_identifier=223280 tubulin alpha length=411 TIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAA NNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVD YGKKSKLEFSIYPARQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIE RQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIE • Dump annotated protein sequences from GUS to FASTA file - with GUS Ids
External Resources: • NCBI Taxonomy (SRes) • SO (SRes) • NRDB (DoTS) • Our data (DoTS) Plugins Web Development Kit GUS helper scripts • Analysis Input: • contigs • proteins • NRDB Plugins Analysis Analysis Results
Data Analysis - BLASTP • Run BLASTP algorithm with these two GUS Id labeled datasets • used a Perl wrapper to BLAST executable, included with GUS... plugin compatible output • Load BLAST results with plugin • ga GUS::Common::Plugin::LoadBlastSimFast --file blastSimilarity.out --restartAlgInvs "" --queryTable DoTS::ExternalNASequence --subjectTable DoTS::ExternalAASequence --commit
Post Data Loading • Find where the results were loaded • read documentation • ga GUS::Common::LoadBLAST --help • looked in plugin source code • asked other users • gusdb.org schema browser • fishing expeditions in GUS tables
External Resources: • NCBI Taxonomy (SRes) • SO (SRes) • NRDB (DoTS) • Our data (DoTS) Plugins Web Development Kit GUS helper scripts • Analysis Input: • contigs • proteins • NRDB Plugins Analysis Results
Web Development Kit (WDK) • provides accelerated development of database driven web sites • define questions and records in model XML file • default JavaServer Pages (JSP) views provided • not specific to GUS • can be used with any RDBMS
WDK Question - Summary - Record Paradigm • Users supply parameter values to a canned question on the website • "Which genes have at least __ exons?" • The result is returned in summary pages that list links to the record pages • Record page - detailed view of data object • text • graphics • tables
Questions Summary Record
WDK Model - View - Controller architecture • Model XML configuration defines • questions • answer summaries • records • View • displays the model • defined in customizable JavaServer pages • Controller • internal, not configurable
WDK Setup • build • write WDK model (WDK comes with Toy site - spent some time with that before hand) • test model from command line • install WDK into Tomcat • customize the view (jsp) pages • integrate Tomcat with Apache - personal preference
WDK Model:Defining Questions <question name="GeneByContig" displayName="Genes by Contig" queryRef="GeneFeatureIds.GeneByContig" summaryAttributesRef="source_id,product,organism,contig" recordClassRef="GeneRecordClasses.GeneRecordClass"> <description>Find gene located on a given contig</description> </question>
<sqlQuery name="GeneByContig" displayName="By Contig" isCacheable='true'> <description> Find Genes By Contig ID. </description> <paramRef ref="params.contig"/> <column name="source_id" isInternal="false"/> <sql> <!-- use CDATA because query includes angle brackets --> <![CDATA[ select g.source_id from dots.genefeature g, dots.naentry nae, dots.sequencetype st, dots.externalNAsequence enas where nae.na_sequence_id = g.na_sequence_id and enas.sequence_type_id = st.sequence_type_id and enas.na_sequence_id = nae.na_sequence_id and st.name = 'contig' and nae.source_id = '$$contig$$' ORDER BY g.source_id ]]> </sql> </sqlQuery>
WDK Model - Record <recordClass idPrefix="" name="GeneRecordClass" type="Gene" attributeOrdering="source_id,exoncount,overview, product,linkout,dnaContext,genomeCompare,tmdata,blastpgraphic, translation,sequence,reference"> <attributeQueryRef ref="GeneAttributes.GeneAttrs"/> <attributeQueryRef ref="GeneAttributes.ExonCount"/> <attributeQueryRef ref="GeneAttributes.TMCount"/> <tableQueryRef ref="GeneTables.BlastP"/> <textAttribute name="overview" displayName="Overview"> <text> <![CDATA[ This <b><i>$$organism$$</i></b> gene spans positions <b>$$start_max$$</b> - <b>$$end_min$$</b> of contig <a href="showRecord.do?id=$$contig$$"><b>$$contig$$</b></a> which maps to chromosome <b>$$chromosome$$</b> ]]> </text> </textAttribute> </recordClass>
Testing the Modelcommand line tools • wdkXml - check xml syntax • wdkSummary - test a summary • wdkQuery - run specific query • wdkRecord - test a record • wdkSanityTest - exercises all queries and records • wdkCache
Install WDK into Tomcat • follow the installation instructions carefully • relies on symbolic links from Tomcat webapp to $GUS_HOME • disallowed by default Tomcat configuration • keep an eye on Tomcat logs for troubleshooting • reload the webapp when model changes • retest on command line • don't forget about the cache
CryptoDB Custom View • Made style changes, added site branding • Added additional form elements • radio buttons, check boxes • 'Flattened out' the questions
CryptoDB Custom View • Record pages - alterations to acheive the desired ordering and placement of text, tables and graphics • Standard JSP tags to embed external objects • GBrowse graphic
Integrate Tomcat with Apache • Apache front end answers all web requests • Serves the static pages and cgi tools • BLAST interface • motif search • BLASTX keyword search • Calls to the WDK are passed to Tomcat
External Resources: • NCBI Taxonomy (SRes) • SO (SRes) • NRDB (DoTS) • Our data (DoTS) Plugins Web Development Kit GUS helper scripts • Analysis Input: • contigs • proteins • NRDB Plugins Analysis Results
Pipeline • External Resources: • NCBI Taxonomy (SRes) • SO (SRes) • NRDB (DoTS) • Our data (DoTS) Plugins Web Development Kit GUS helper scripts • Analysis Input: • contigs • proteins • NRDB Plugins Analysis Results