1 / 8

ASM/JGI Bioinformatics Institute

ASM/JGI Bioinformatics Institute. Ellen Aho Concordia College Moorhead Minnesota. Research students Upper-level microbiology students Introductory-level genetics students. Research students: Neisseria meningitidis gene curation.

Télécharger la présentation

ASM/JGI Bioinformatics Institute

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. ASM/JGI Bioinformatics Institute Ellen Aho Concordia College Moorhead Minnesota

  2. Research students • Upper-level microbiology students • Introductory-level genetics students

  3. Research students:Neisseriameningitidisgene curation BIGSdb: Scalable analysis of bacterial genome variation at the population level Keith A Jolley and Martin CJ Maiden • BMC Bioinformatics 2010, 11:595 >pilS1 DIKGKYVKEVKVANGVITATMLSSGVNNEIKGKKLSLWAKRQNGSVKWFCGQPVARADKAKDDVKAATANGTDDKINTKHLPSTCRDDSS http://www3.imperial.ac.uk

  4. Research students • Building confidence • Student training resources • Data management ideas • Alignment tools

  5. Microbiology students:commensalNeisseria genomes • Genome sequencing reveals widespread virulence gene exchange among human Neisseria species Marri et al. • PLoS One 2010, 5:e11835

  6. Microbiology students • IMG-ACT workshop • Identify interesting questions and multiple places to integrate into syllabus • Identify tools and begin to design assignments

  7. Microbiology students • 1. Introduction to Neisseria • N. meningitidiscomparative genomics article • Review of NCBI, introduction to IMG: find genomes of different • meningococcal serogroups • Phylogenetic profiler: comparisons amongst meningococci – • open genome, pangenome • Lab time during bacterial genetics/antibiotic resistance section of class • Antibiotic resistance gene via HGT article • Introduction to commensal genomes • Retrieve gene(s), BLAST all commensals • HGT analyses 3. During vaccine section: group projects – research candidate vaccine antigens • Students find articles about neisserial vaccine development • Make class list of candidate antigens • Groups investigate a given candidate antigen • Would a vaccine that elicits an immune response against this meningococcal antigen be likely to affect normal flora?

  8. Group projects • Normal function of candidate antigen • Find N. meningitidisgene in database • Cell location tools • BLAST commensal genomes • MUSCLE alignments of protein sequences, WebLogo • Class poster session

More Related