1 / 22
Télécharger la présentation

CD8 T cell

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript

Playing audio...

  1. P P. Chames G. Rosas L. Rem R. Willemsen R. Bolhuis HR. Hoogenboom Affinity-matured MHC-peptide specific phage-antibodies for targeting T-cell rejection antigens on melanoma cells CD8 T cell Target cell

  2. Tumors are immunogenic… A large number of tumor antigens have been described, especially on melanomas. A large number of them are peptides presented by MHC complexes. Their expression often limited to tumor cells make them attractive for immunotherapy peptide 8-9 aa Heavy chain(35KDa) b2m (12 KDa)

  3. An antibody directed against this complex would be interesting to: • Check the availability of the complex before immunotherapy (in vitro MAGE-A1 loaded DC) • As a targeting reagent (immunotoxin/cytokine, T cell retargeting) The complex HLA-A1/MAGE-A1 • MAGE-A1 expressed in 40% of melanoma tumors and in some other tumors • 25 % of the population is HLA-A1 positive => the HLA A1-MAGE-A1 complex is expressed in 10% of all melanoma tumors. • Not expressed at all in normal tissues (apart from testis, but no HLA expression)

  4. The peptide-MHC complex is recognized by the TCR Adapted from Garcia KC et al. 1996 Science 274:209–19

  5. Separate cloning of the HLA A1 and b2m in intracellular expression vectors Purification of the inclusion bodies from E. coli Dissolution in 8M urea buffer Dilution in a reconstitution buffer in the presence of the three partners (reduced and oxidized glutathion) Production of a recombinant complex

  6. In vitro Refolding: Results • After reconstitution and concentration, the mix is analyzed by gel filtration and SDS-page HC b2m 1 2 3 3 Refolding 1 concentration 2 buffer

  7. TNF 70 60 50 CTL 82/30 40 TNF (pg/ml) 30 20 A1MA1 - CTL413/13 10 A2MA3 - CTL82/30 0 A1MA1 - CTL82/30 50 17 Aggregates b2m Complex Strep/biot. Complex 5 2 0.6 Complexes (µg/ml) The complex is correctly refolded

  8. Selection from a large non immunized human Fab fragment repertoire Repertoire: 3.7x1010 Strep. + pMHC DTT 50 mM ss Strep. b Round 4 = Streptavidin

  9. 2.5 OD 450 nm 2 1.5 1 0.5 0 A1 D2 G8 Tü 155 HK Screen for peptide specificity Peptide MAGE-A3 Peptide MAGE-A1 EADPTGHSYEVDPIGHLY Out of 14 different binders: 11 were pan-reactive 2 had a differential binding (D2) 1 was fully MAGE-A1 specific (G8)

  10. LG2-EBV AVL3-EBV MZ2-EBV HLA-A1- HLA-A1+ HLA-A1+ fd H2 fd G8 G8 binds the pMHC complex on cell surface B cells (HLA-A1 positive or neg.) are in vitro loaded with MAGE-A1 or MAGE-A3 and used in FACS experiment with the phage-antibody G8 Loaded with MAGE-A3 Loaded with MAGE-A1

  11. A1/MAGE1 Fab-G8 fusion Melanoma cells Transfected human T-cells Fab-G8 can efficiently retarget primary human lymphocytes Fusion of G8 with a signaling element (FceR1g) and retroviral transfection of human PBL % Cr release Transfected lymphocytes kill MAGE-A1 loaded cells Transfected lymphocytes kill MAGE-A1 + melanoma cells

  12. Or with MAGE-A1+ melanoma cells MAGE-A1+ MAGE-A1+ Fab-G8 can efficiently retarget primary human lymphocytes Production of cytokines by transfected human T cells upon incubation with MAGE-A1 loaded cells

  13. + DTT - DTT L FT E L FT E 45 30 SDS PAGE Purification of the recombinant Fab fragment GEL FILTRATION Yield: 1.2 mg/l (from periplasmic fraction, after metal affinity chromatography and gel filtration)

  14. RU MAGE-1 (625, 542, 459, 375, 292, 208 nM) 400 300 200 100 MAGE-3 (625 nM) 0 590 604 618 632 646 660 Time (s) Surface plasmon resonance measurements kon: 1.8x105 M-1S-1 koff: 45x10-3 S-1 Kd = koff / kon = 250 nM

  15. Affinity maturation G8 has a moderate affinity • 250 nM may be enough for diagnosis purposes (FACS and tissue staining) • but we need at least a 10 fold better affinity for in vivo targeting The problem • We want to increase the • affinity BUT • we don’t want to lose the • specificity • The new interactions have to be made ONLY with the peptide (around 20% of the interface)

  16. Affinity maturation: The libraries • Chain Shuffling library The G8 light chain is shuffled with a kappa + lamdba repertoire VlCl VHCH1 G8 Diversity 2x108 • CDR H3 spiking EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARGGGFHYYYYGMDVWGQGTTVTVSS VH G8 SPIKING: for each base of the codon, 90% WT and 10% of ACGT -> few mutations per clone, scattered over CDR H3 Diversity 3.107

  17. HYB3 (combination) 3H2/ 4E3 (direct selections) G8 Name kon(105 M-1s-1) koff(10-3 s-1) Kd (nM) G8 1.8 45 250 3H2 2.1 16 75 hyb3 3.8 5.4 14 Selection: Results Selection of mutations with additive effect

  18. Fine specificity analysis E A D P T G H S Y E V D P I G H L Y EAD P I G H L Y E V D P T G H L Y E V D P I G HSY C T E L K L S D Y CAE L K L S D Y C T E LTL S D Y C T E L K L SSY MAGE-A1 1.8 1.6 MAGE-A3 OD405nm 1.4 M3A 1.2 M3T 1 0.8 M3S 0.6 INF 0.4 INFA 0.2 0 INFT TÜ155 G8 lac7 Hyb3 H2 INFS Affinity-matured clones did not lose their fine specificity

  19. The selected sequences Vl sequences VH sequences Difficult to localize the crucial mutations (long range effects…)

  20. Fab-G8 model (swissprot) Lys30 Tyr107 VH Gly100 Val111 VL

  21. Conclusions Abstract -> We have produced a recombinant version of the tumor-related peptide-MHC complex HLA-A1/MAGE-1 and used it for phage selection (works as well as HLA tetramer to stain and sort specific T cells) -> We have selected a fully human Fab fragment binding to this epitope in vitro (ELISA, BIAcore) and on cell surface (FACS) -> We have increased the affinity of the antibody by a factor 18 without loss of specificity. -> We have shown that the Fab fragment can be efficiently used as a surface receptor to retarget human T cells against HLA-A1 / MAGE-A1 positive cells

  22. Perspectives Crystallography -> G8 and HLA-A1/ MAGE-A1 have been produced and purified in high amounts for crystallographic studies ->The pMHC-Fab complex can be purified by gel filtration -> The high affinity version will also be produced

More Related