elle
Uploaded by
19 SLIDES
426 VUES
200LIKES

Sequence Databases

DESCRIPTION

Sequence Databases. April 28, 2005

1 / 19

Télécharger la présentation

Sequence Databases

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. Sequence Databases • April 28, 2005 • Learning objectives-Understand how information is stored in GenBank. Learn how to read a GenBank flat file. Learn how to search GenBank for information. Understand difference between header, features and sequence. Distinguish between a primary database and secondary database. • Writing topic • Homework#4 and Workshop#4 due today • Homework#9 due May 3.

  2. BIOSEQUENCES (Bioseq) • Biological sequence-central element in the NCBI data model. • Comprises a single continuous molecule of nucleic acid or protein. • Must have at least one sequence identifier (Seq-id) • Information on physical type of molecule (DNA, RNA or protein) • Annotations-points out important features at specific locations within the Bioseq • Descriptors-describe entire Bioseq

  3. What is GenBank? • Gene sequence database • Annotated records that represent single contiguous stretches of DNA or RNA-may have more than one coding region (limit 350 kb) • Generated from direct submissions to the DNA sequence databases from the authors. • Part of the International Nucleotide Sequence Database Collaboration.

  4. http://www.ncbi.nlm.nih.gov/Genbank/genbankstats.html

  5. History of GenBank • Began with Atlas of Protein Sequences and Structures (Dayhoff et al., 1965) • In 1986 it joined EMBL and in 1987 it joined DDBJ. • It is a primary database-in other words, experimental data is placed into it. • Examples of secondary databases derived from GenBank/EMBL/DDBJ: Swiss-Prot, PRI. • GenBank Flat File is a human readable form of a GenBank record.

  6. General Comments on GBFF • Three sections: • 1) Header-information about the whole record • 2) Features-description of annotations-each represented by a key. • 3) Nucleotide sequence-each ends with // on last line of record. • DNA-centered • Translated sequence is a feature

  7. Feature Keys • Purpose: • 1) Indicates biological nature of sequence • 2) Supplies information about changes to sequences • Feature KeyDescription conflict Separate determinations of the same seq. differ rep_origin Origin of replication protein_bind Protein binding site on DNA CDS (Protein) coding sequence

  8. Feature Keys-Terminology Feature Key Location/Qualifiers CDS 23..400 /product=“alcohol dehydro.” /gene=“adhI” The feature CDS is a coding sequence beginning at base 23 and ending at base 400 that has a product called “alcohol dehydrogenase” and corresponds to the gene called “adhI”.

  9. Feature Keys-Terminology (Cont.) Feat. Key Location/Qualifiers CDS join (544..589,688..1032) /product=“T-cell recep. B-ch.” /partial The feature CDS is a partial coding sequence formed by joining the indicated elements to form one contiguous sequence encoding a product called T-cell receptor beta-chain.

  10. Record from GenBank GenBank division (plant, fungal and algal) Locus name Modification date LOCUS SCU49845 5028 bp DNA PLN 21-JUN-1999 DEFINITION Saccharomyces cerevisiae TCP1-beta gene, partial cds, and Axl2p (AXL2) and Rev7p (REV7) genes, complete cds. ACCESSION U49845 VERSION U49845.1 GI:1293613 KEYWORDS . SOURCE baker's yeast. ORGANISM Saccharomyces cerevisiae Eukaryota; Fungi; Ascomycota; Hemiascomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces. Unique identifier (never changes) Coding sequence GeneInfo identifier (changes whenever there is a change) Nucleotide sequence identifier (changes when there is a change in sequence (accession.version)) Word or phrase describing the sequence (not based on controlled vocabulary). Not used in newer records. Common name for organism Formal scientific name for the source organism and its lineage based on NCBI Taxonomy Database

  11. Record from GenBank (cont.1) Oldest reference first REFERENCE 1 (bases 1 to 5028) AUTHORS Torpey,L.E., Gibbs,P.E., Nelson,J. and Lawrence,C.W. TITLE Cloning and sequence of REV7, a gene whose function is required for DNA damage-induced mutagenesis in Saccharomyces cerevisiae JOURNAL Yeast 10 (11), 1503-1509 (1994) MEDLINE 95176709 REFERENCE 2 (bases 1 to 5028) AUTHORS Roemer,T., Madden,K., Chang,J. and Snyder,M. TITLE Selection of axial growth sites in yeast requires Axl2p, a novel plasma membrane glycoprotein JOURNAL Genes Dev. 10 (7), 777-793 (1996) MEDLINE 96194260 Medline UID REFERENCE 3 (bases 1 to 5028) AUTHORS Roemer,T. TITLE Direct Submission JOURNAL Submitted (22-FEB-1996) Terry Roemer, Biology, Yale University, New Haven, CT, USA Submitter of sequence (always the last reference)

  12. Record from GenBank (cont.2) There are three parts to the feature key: a keyword (indicates functional group), a location (instruction for finding the feature), and a qualifier (auxiliary information about a feature) FEATURES Location/Qualifiers source 1..5028 /organism="Saccharomyces cerevisiae" /db_xref="taxon:4932" /chromosome="IX" /map="9" CDS <1..206 /codon_start=3 /product="TCP1-beta" /protein_id="AAA98665.1" /db_xref="GI:1293614" /translation="SSIYNGISTSGLDLNNGTIADMRQLGIVESYKLKRAVVSSASEA AEVLLRVDNIIRARPRTANRQHM" Location Keys Qualifiers Partial sequence on the 5’ end. The 3’ end is complete. Start of open reading frame Descriptive free text must be in quotations Database cross-refs Protein sequence ID # Values Note: only a partial sequence

  13. Record from GenBank (cont.3) Another location gene687..3158 /gene="AXL2" CDS 687..3158 /gene="AXL2" /note="plasma membrane glycoprotein" /codon_start=1 /function="required for axial budding pattern of S. cerevisiae" /product="Axl2p" /protein_id="AAA98666.1" /db_xref="GI:1293615" /translation="MTQLQISLLLTATISLLHLVVATPYEAYPIGKQYPPVARVN. . . “ gene complement(3300..4037) /gene="REV7" CDS complement(3300..4037) /gene="REV7" /codon_start=1 /product="Rev7p" /protein_id="AAA98667.1" /db_xref="GI:1293616" /translation="MNRWVEKWLRVYLKCYINLILFYRNVYPPQSFDYTTYQSFNLPQ . . . “ Cutoff Another location Cutoff

  14. Record from GenBank (cont.4) BASE COUNT 1510 a 1074 c 835 g 1609 t ORIGIN 1 gatcctccat atacaacggt atctccacct caggtttaga tctcaacaac ggaaccattg 61 ccgacatgag acagttaggt atcgtcgaga gttacaagct aaaacgagca gtagtcagct . . .//

  15. EBI Sequence Retreival System SRS-author SRS-accession number SRS-title SRS-reference SRS-organism EMBL Parts of the record are parsed into separate database files

  16. Protein databases derived from GenBank containing data for a single gene • Non-redundant (nr) • Swissprot • PIR protein DNA RNA cDNA DNA databases derived from GenBank containing data for a single gene • Non-redundant (nr) • dbGSS • dbHTGS • dbSTS RNA (cDNA) databases derived from GenBank containing data for a single gene • dbEST • UniGene

  17. Primary databases vs. Secondary databases • Primary database has information from experimenter. It is called an archival database • Secondary database derives information from primary database. It is a curated datebase

  18. GenBank/EMBL/DDBJ dbEST-expressed sequence tags-single pass cDNA sequences (high error freq.) It is non-redundant HTGS-high-throughput genomic sequence database (errors!) PDB-Three-dimensional structure coordinates of biological molecules PROSITE-database of protein domain/function relationships. Types of primary databases carrying biological infomation

  19. dbSTS-Non-redundant db of sequence-tagged sites (useful for physical mapping) Genome databases-(there are over 20 genome databases that can be searched EPD:eukaryotic promoter database NR-non-redundant GenBank+EMBL+DDBJ+PDB. Entries with 100% sequence identity are merged as one. Vector: A subset of GenBank containing vector DNA ProDom PRINTS BLOCKS Types of secondary databases carrying biological infomation

More Related