1 / 7

Protein Analysis (Beyond BLAST)

Protein Analysis (Beyond BLAST). Basic Protein Data (MW, pI) Generalized Features Multiple Sequence Alignments Fingerprints, Profiles, Domains Using Structure. Multiple Sequence Alignments Comparison of Methods. DIALIGN.

illias
Télécharger la présentation

Protein Analysis (Beyond BLAST)

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. Protein Analysis (Beyond BLAST) • Basic Protein Data (MW, pI) • Generalized Features • Multiple Sequence Alignments • Fingerprints, Profiles, Domains • Using Structure

  2. Multiple Sequence AlignmentsComparison of Methods DIALIGN At         368   LY-------- ---------- --AEVAYHNF APPHVTKNSY FAAILGHNNNPY54             383   AY-------- ---------- --EKWFRTDP RWAKCDEDVF FSELLGHD--VHML             273   HHyqrvshts hgefsfrlpg hlCRIAFHEF RHNGESKAAF RSRVLGHSGGBB003            298   IY-------- ---------- --CKFSYLAF APKNMEMNYW ITKVLGHEPNN15              390   AY-------- ---------- --EMFFRVDP RWKNVDEDVF FMEILGHD--Ecto             304   SH-------- ---------- --RTFk---- --NNCSINIW LTKTLLHE-- At               398   DLETSLSYMT YTL------- ---------- ---------- ----------PY54             411   DPDTQLAYKQ FKL------- ---VNFNPKW TPNISDENPR LAALQELDNDVHML             323   DKSTQNHYEG FELdskveti gvvDMGQNEA DKSYNKQL-- LKHLEQYDATBB003            328   DITTAFHYNR YVL------- ---DNLDDKA DNSLLTLL-- NQRIYTYVRRN15              418   DENTQLHYKQ FKL------- ---ANFSRTW RPEVGDENTR LVALQKLDDEEcto             326   ALDTSIFYSR FRI------- ---DKCStnr gewaf----- ---------- ClustalW PY54 FRTDPRWAKCDEDVFFSELLGHD--DPDTQLAYKQFKLVNFNPKWTPNISDENPRLAALQ 456 N15 FRVDPRWKNVDEDVFFMEILGHD--DENTQLHYKQFKLANFSRTWRPEVGDENTRLVALQ 452 Ecto K------NNCSINIWLTKTLLHE--ALDTSIFYSRFRIDKCS------------------ 342 VHML R-----HNGESKAAFRSRVLGHSGGDKSTQNHYEGFELDSKVETIG-------------- 343 At AP-----PHVTKNSYFAAILGHNNNDLETSLSYMTYTLPEDR------------------ 414 BBB03 AP-----KNMEMNYWITKVLGHEPNDITTAFHYNRYVLDNLD------------------ 344

  3. Multiple Sequence Alignments • Method of choice depends upon goal of alignment • FMI – Thompson et al., 1999. Nucleic Acids Research 27:2682-90. A comprehensive comparison of multiple sequence alignment programs.

  4. Multiple Sequence Alignment Protein/Position within SequenceSequence YNZ5_YEAST/135-152           RLCYNCNETGHISKDCPKO65639/100-117               SGCYNCGELGHISKDCGIQ94821/1600-1617             KGCFNCGEEGHQSRECTKBYR3_SCHPO/17-34             PRCYNCGENGHQARECTKO44758/570-587               RGCHNCGEEGHISKECDKGLH1_CAEEL/262-279           RGCFNCGEQGHRSNECPNO96068/51-68                 KGCFKCGEEGHMSRECPQHEXP_LEIMA/43-60             TTCFRCGEEGHMSRECPNO46363/5-22                  VTCYKCGEAGHMSRECPKHEXP_LEIMA/196-213           RKCYKCGESGHMSRECPS

  5. Pattern Searches Ultimate Goal Atwood, 2000, Int. J. Biochem. Cell Biol. 32:139-55

  6. Pattern Searches 3 Levels Atwood, 2000, Int. J. Biochem. Cell Biol. 32:139-55

  7. Pattern Searches Hidden Markov Model Atwood, 2000, Int. J. Biochem. Cell Biol. 32:139-55

More Related