luke
Uploaded by
66 SLIDES
5881 VUES
1180LIKES

Post-translational modifications

DESCRIPTION

Post-translational modifications. Post-translational Modification of Proteins Expanding Nature’s Inventory (2006) by C.T. Walsh ISBN 0-9747077-3-2. Just for introduction. Genome ↓ Transcription – mRNA ↓ Translation – proteins + co-translational modifications ↓

1 / 66

Télécharger la présentation

Post-translational modifications

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. Post-translational modifications Post-translational Modification of Proteins Expanding Nature’s Inventory (2006) by C.T. Walsh ISBN 0-9747077-3-2

  2. Just for introduction Genome ↓ Transcription – mRNA ↓ Translation – proteins + co-translational modifications ↓ Post-translational modifications

  3. Post-translational modifications I • Enzymatic processing • N-, O-, C-linked glycosylation – Asn, Ser/Thr/Hyl/Hyp, Trp • Phosphorylation – Tyr, Ser, Thr, His, Asp • Acylation acetylation of the N-terminus fatty acid anchors on Cys • Cross-linkage – Lys, Trp, Tyr, Met • Oxydation – Cys, Met, Trp, Tyr, His • Methylation – N-terminus, Arg, Lys • Ubiquitination - Lys

  4. Post-translational modifications II • Cannot be predicted – though consensus sequences have been reported for some of them • Organism-dependent • Can be tissue- or location-specific • Stable or dynamic – high and low level • Alters biological activity, and physical properties • May alter the immune response ↓

  5. How to find PTMs? Sometimes proteins give us a clue: • higher/lower/wider band on SDS-PAGE For example, +~5 kDa on SDS-PAGE may indicate 1 occupied N-linked glycosylation site • multiple spots with IEF or on 2D-gel • higher MW with gel-filtration or native gel-elfo • altered hydrophobicity • altered immunochemistry • altered biological activity • “blank” cycle in Edman sequencing (with proper standard & altered chromatography the modification could be identified: Identification of glycosylation sites in mucin peptides by edman degradation. Zachara NE, Gooley AA. Methods Mol Biol. 2000;125:121-8. Review.

  6. How to find PTMs? Sometimes we’re searching for something specific • using a known donor and radioactive labeling ATP for phosphorylation (Why cannot we use this approach for glycosylation?) • using modification-specific derivatization and staining or enrichment Periodate oxidation and labeling for glycosylation • using modification-specific antibodies Against phosphoTyr • using modification-specific enzymes Phosphatase or glycosidase treatment • Mass spectrometryMass Spectrometry Mass Spectrometry!

  7. Sample preparation • Does the modification survive? • Losses due to enzymatic reactions Phosphatase activity for phosphopeptides • Losses due to chemical reactions Acid-sensitive modifications, such as phosphoHis • Losses due to different physical properties Fatty-acylated or glycopeptides • Do we introduced some modifications? * Biological artifacts * Chemical side reactions

  8. Some modifications that occur in vivo and can be introduced in vitro • Carbamidomethylation of N-termini and Lys side-chains • Formylation of Lys side-chains • Asn cyclization; b-aspartame formation; deamidation • Oxidation • Glu, Asp methyl ester formation And the list goes on…

  9. Finding the N-termini • 80-90% of the eukaryotic proteins is acetylated If 2nd aa: G, A, S, C, T, P, V • Met-1 is clipped of; Ac- is added to G, A, S, T If 2nd aa: E, D, Q, M, I, L, W, F – persisting Met gets acetylated

  10. Finding the N-termini • N-terminal sequencing • Positive enrichment (Wells-group); subtiligase-mediated selective N-terminal labeling with biotin-containing probe; enrichment; release with TEV protease; MS-analysis “Global sequencing of proteolytic cleavage sites in apoptosis by specific labeling of protein N termini.” Mahrus S, Trinidad JC, Barkan DT, Sali A, Burlingame AL, Wells JA. Cell. 2008 Sep 5;134(5):866-76. • Negative enrichment – next slide

  11. Finding the N-termini • McDonald L, et al., Positional proteomics: selective recovery and analysis of N-terminal proteolytic peptides.Nat Methods. 2005 Dec;2(12):955-7. Epub 2005 Nov 18.

  12. Modified N-terminus Modified side-chain

  13. Methylation (mono, di, tri - +14, +28, +42 Da) • N-terminus, Lys, Arg, His • Trimethyl – acetyl = 36 mmu Accurate mass measurement helps; Fragmentation is different too • Glu (Asp) may form Me-ester – upon CBB staining (MeOH + acid) + 14 Da

  14. FT ICR MS

  15. Asn-Val-Ser-Val-Lys(Me3)-Glu-Ile-Lys - 59 Da

  16. Disulfide-bridges • in membrane and secreted proteins important 3D structure feature • Some toxins and antibacterial peptides feature characteristic Cys network • -S-S- prone to shuffling @ basic pH

  17. How to find & determine disulfide linkages? • Alkylate the free SHs; digest the protein; fractionate the digest; reduce/or oxidize the fractions; look for altered chromatographic behavior; identify the components * Optimal pH for alkylation is good for shuffling too * Digestion may be hindered by a compact structure * Multiple links could be present within one cleavage product * If oxidation is used, Met, Trp also may be altered

  18. A “novel” methodology for assignment of disulfide bond pairings in proteins. • Wu J, Watson JT. Protein Sci. 1997 Feb;6(2):391-8. • Reduction by TCEP (works at low pH); cyanylation of nascent –SHs; fractionation of partially reduced forms; cleavage at the N-termini of the modified Cys-residues (with NH4OH) * Fractionation of complex, partially reduced mixtures could be a problem…

  19. Assigning disulfide-bridges I Reduction/alkylation Reduction/alkylation m/z I Digestion @ low pH Digestion @ low pH m/z I Reduction/alkylation MS/MS I Reduction/alkylation m/z I m/z m/z

  20. Synthetic Ac-TIMP-1(Ser175)126-184 ECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCS WQSLRSQIA Where are the disulfide bridges? * digestion with trypsin @ pH 6; * with pepsin in acid Bodi, N. et al., J. Pept. Sci.9, 430-441 (2003).

  21. [33-37] 41-49 [38-44]-[45-55] intensity [38-44] Ac[1-13]-[45-55] 2-7, 12-49 20-41 [45-55] [14-32]-[38-44] free SH 41-49 [38-55] Free SH 600 800 1000 1200 2000 2200 2400 2600 2800 3000 m/z m/z S* [45-55] 2 S* [38-55] 3 S* Ac[1-13] intensity 1 S* [14-37] 1 S* [14-32] Ac[1-13] 1 S-S, 1 S* Ac[1-13] 1free SH, 2 S* 2 S* S* [38-59] [38-44] 1 S* [33-37] [45-59] 1600 1800 2000 2200 2400 2600 2800 3000 600 800 1000 1200 1400 1600 m/z m/z MALDI-TOF analysis of the tryptic digest In-source reduction PSD

  22. Disulfide bridges in TIMP-1 C-terminal domain: [38-44]-S-S-[45-55], PSD of MH+ at m/z 2082.1 MALDI-PSD/CID yields characteristic triplets

  23. No characteristic triplets in ESI-CID

  24. Disulfide Bridges The ProteinProspector mass modification search can be used in conjunction with MS-Bridge to find peptides with disulfide bridges. For this example, mass shifts between 0-2000 Da were considered. (1023.3276+4). KLSWADLIVFAGNCALESMGFK+4 VSFADLVVLGGCAAIEK

  25. Glycosylationhttp://glycores.ncifcrf.gov/Reference: Essentials of Glycobiologyby Varki et al.

  26. N-linked AsnXxxSer/Thr/Cys

  27. Further processing

  28. N-linked glycosylation • consensus sequence • GlcNAc2Man3 – core oligomannose structure – just Man units complex sugars– GlcNAc-Gal–SA antennae hybrid structures core fucosylation sulfate, phosphate modifications • PNGase F removes all N-linked structures; Asn  Asp

  29. N-linked glycosylation • Incredible heterogeneity: a site may be only partially occupied and may display numerous different carbohydrates • species-, tissue-, cell-type-specificmodification, physiological changes, diseasesmay alter the sugars

  30. certain structures are immunogenic Gal a1-3 capping, Fuc a1-3 on inner GlcNAc; blood group determinants

  31. Characterization of N-linked carbohydrate pool • PNGase digestion; sugar/protein separation; carbohydrate analysis without derivatization * High pH anion exchange chromatography with pulsed amperometric detection * NMR * MS • After modifying the reducing terminus (Advantage of the derivatization: improved “visibility”) * Electrophoresis with a combination of endoglycosidase cocktails “Elucidation of N-linked oligosaccharide structures of recombinant human factor VIII using fluorophore-assisted carbohydrate electrophoresis.” Kumar HP, Hague C, Haley T, Starr CM, Besman MJ, Lundblad RL, Baker D. Biotechnol Appl Biochem. 1996 Dec;24 ( Pt 3):207-16. * Capillary electrophoresis No information on the modification sites and site heterogeneity

  32. N-linked glycoproteins • Periodate oxidation & color-reaction on gels • Periodate oxidation & capture on hydrazide resin; release with PNGase F • Western blot with protein- & sugar-specific antibody Non-specific background; co-migrating proteins will interfere

  33. N-linked glycopeptides(analysis of purified proteins only) • Identification from diagnostic fragments: * HexNAc m/z 204 * HexHexNAc m/z 366 Precursor scan, or „ping-pong” acquisition • Identification from oligosaccharide heterogeneity • enrichment by HILIC or lectin-chromatography K.F. Medzihradszky Meth. Enzymol.405, 116-138 (2005).

  34. human lecithin:cholesterol acyltranferase and apolipoprotein D, tryptic digest, LC/MS analysis

  35. Recombinant Factor VIII, 50 kDa subunit MHTVNGYVN*R

  36. AG(Man8GlcNAc2)NVSNIIPASATLNADVR peptide+GlcNAc

  37. About the structures of N-linked glycopeptides • from the measured mass, and the CID spectrum the modified peptide can be identified + the size and class of the sugar Automated N-glycopeptide identification using a combination of single- and tandem-MS.Goldberg D, Bern M, Parry S, Sutton-Smith M, Panico M, Morris HR, Dell A.J Proteome Res. 2007 Oct;6(10):3995-4005. • the identity of the sugar units and their linkage positions CANNOT be determined • NMR, exo- and endoglycosidases are needed to complete the job

  38. [MHNa2]3+ of QV(Man10GlcNAc2)NIT and [MH2Na] 3+ of QV(Man9GlcNAc2)NITGK

  39. One component from the previous slide K.F. Medzihradszky Meth. Enzymol.405, 116-138 (2005).

  40. O-linked sugars • No consensus sequence • No common core structure • No universal enzyme b-elimination works (NaOH) sugars have to be reduced upon release Detection is problematic – because of heterogeneity & variable site occupancy Site assignment is even harder

  41. O-linked sugars a3

  42. Other O-linked core structures • Fuc Harris, R.J. & Spelmann, M.W. (1993) Glycobiology,3, 219-224. • Glc Nishimura, H et al., (1989) J. Biol. Chem.264, 20320-20325. • Man – in yeast ____________________________________ • GlcNAc – single unit; INSIDE the cell

  43. Characterization of O-linked carbohydrate pool • Release with NaOH or hydrazynolysis • Reducing end is usually derivatized i) to prevent peeling ii) to increase “visibility” • Methods just like for N-linked sugars • NMR; HPAE-PAD; capillary and gel-elfo; glycosidase cocktails; MS No information on site occupancy and heterogeneity

  44. O-linked glycopeptides • Known protein - Elucidation of O-glycosylation structures of the beta-amyloid precursor protein by liquid chromatography-mass spectrometry using electron transfer dissociation and collision induced dissociation. Perdivara I, Petrovich R, Allinquant B, Deterding LJ, Tomer KB, Przybylski M. J Proteome Res. 2009 Feb;8(2):631-42. • Known sugar structure - Zsuzsanna Darula and Katalin F. Medzihradszky “Affinity Enrichment and Characterization of Mucin Core-1 Type Glycopeptides from Bovine Serum” Mol. Cell. Proteomics, Nov 2009; 8: 2515 - 2526. • Perseverance & luck - Crina I.A. Balog, Oleg M. Mayboroda, Manfred Wuhrer, Cornelis H. Hokke, André M. Deelder, and Paul J. Hensbergen. “Mass spectrometric identification of aberrantly glycosylated human apolipoprotein C-III peptides in urine from Schistosoma mansoni-infected individuals.” MCP published January 13, 2010, 10.1074/mcp.M900537-MCP200

  45. Typical CID of an O-linked glycopeptide 1888.2 + GalNAcGalSA

  46. J. Am. Soc. Mass Spectrom. 7, 1996, 319-328. CID fragmentation of O-linked glycopeptides

  47. CID vs ETD b c NH2-CH(R1)-CO-NH-CH(R2)-CO-…-NH-CH(Rn)-COOH y z. The weakest bonds go first; glycosidic bond; phosphate … radical ions fragment, side-chains usually survive

  48. Inter-alpha-trypsin inhibitor heavy chain H1 precursor ETD of KTFMLQASQPAPT(GalNAcGalSA)HSSLDIK

  49. O-glycosylation within the cell • Regulatory modification of nuclear and cytoplasmic proteins • Single GlcNAc, no extension • 1 glycosyl-transferase (at least 21 for secreted O-linked GalNAc); 1 cytosolic N-Acetyl-b-D-glucosaminidase • Poorly understood due to lack of effective methods for enrichment and detection.

More Related