mercer
Uploaded by
25 SLIDES
396 VUES
250LIKES

Functional Genomics Unveils Survival Genes in Cattle Post Trypanosome Challenge

DESCRIPTION

This research highlights the use of functional genomics to identify the genetic factors influencing survival in cattle, specifically between the resistant N'Dama and susceptible Boran breeds following Trypanosome infection. The study addresses the complexities of separating genetic influence from environmental effects and emphasizes the need for genome-wide analysis. By understanding gene expression variations in response to challenges, this work aims to enhance livestock resilience and informs future breeding strategies considering environmental adaptation.

1 / 25

Télécharger la présentation

Functional Genomics Unveils Survival Genes in Cattle Post Trypanosome Challenge

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. Trinity College Dublin Shirakawa Institute of Animal Genetics KARI-TRC

  2. Shirakawa Institute of Animal Genetics Trinity College Dublin KARI-TRC Functional genomics to identify genes and networks influencing survival following Trypanosome challenge.

  3. Cattle Tsetse Cattle and tsetse Origins of N’Dama and Boran cattle Boran N’Dama

  4. Studying the tolerant/susceptible phenotype has problems: • Separating cause from effect • Separating relevant from irrelevant. • Dominance of the ‘what is happening to this weeks trendy gene/protein/cytokine?’ approach.

  5. A gene mapping approach, by definition, points to the true genetic cause of the difference between resistant and susceptible

  6. B) List of genes in the human on HSA2 A) Anaemia QTL ARHGA15 on BTA2 remains a candidate mRNA profiles indicate that RAC1 the target modulated by ARHGAP15 is differently expressed in Boran and N’Dama cattle.

  7. Cow NDama KFITRRPSLKTLQEKGLIKDQIFGSPLHTLCEREKSTVPRFVKQCIEAVEK Cow Boran KFITRRPSLKTLQEKGLIKDQIFGSHLHTLCEREKSTVPRFVKQCIEAVEK Human KFISRRPSLKTLQEKGLIKDQIFGSHLHTVCEREHSTVPWFVKQCIEAVEK Pig KFITRRPSLKTLQEKGLIKDQIFGSHLHTVCERENSTVPRFVKQCIEAVEK Chicken KFISRRPSLKTLQEKGLIKDQIFGSHLHLVCEHENSTVPQFVRQCIKAVER Salmon KFISRRPSMKTLQEKGIIKDRVFGCHLLALCEREGTTVPKFVRQCVEAVEK Alignment of N’Dama ARHGAP15 with homologues H  P mutation at AA282 Gene frequency

  8. Genotype + Phenotype -> Genetic region -> polymorphism ->understanding ->exploitation

  9. We examined the entire genome for regions involved in one phenotype But can we move to the next level and screen multiple phenotypes simultaneously ?

  10. Livestock are by definition adapted to the landscape they inhabit. Landscape Temperature, altitude, rainfall etc Disease challenge Nutritional challenge Human selection Farming system In Europe these are extremely homogeneous In Africa they are extremely stratified and extremely unstable

  11. Different genotypes respond differently in a given environment. Following trypanosome challenge N’dama live while Boran die. And we can see their genomes responding differently Principle components analysis of data from genome-wide expression analysis comparing gene expression in liver of Ndama (red) vs Boran (blue) in response to infection with T. congolense. Light colour day 29 post infection, dark day 32 post infection. Components 1 and 2. (Components 3 and 4 separate by day post infection)

  12. And the same data for spleen. The biggest effect we see (after tissue) is breed. Principle components analysis of data from genome-wide expression analysis comparing gene expression in spleen of Ndama (red) vs Boran (blue) in response to infection with T. congolense. Light colour day 29 post infection, dark day 32 post infection. Components 1 and 2. (Components 3 and 4 separate by day post infection)

  13. Mouse time course. Liver.

  14. So we need to understand the fit between the livestock genotype and the landscape in which they function. Example Build a road Develop a vaccine Improve (or shut off) market access Change the climate!

  15. Livestock Landscape Genomics • Any change in the landscape changes the optimal livestock type • There is information in the distribution of livestock genotypes across the environment. • The tools -genetic, GIS, farm system analysis - are available now to allow us to ask what features of the genome is exposed to selection by what factors in the environment. • The next level of genome scanning.

  16. Cattle Tsetse Cattle and tsetse There is information in the distribution of livestock genotypes across the environment. Boran N’Dama

  17. To extract information from distribution is a challenge. Input: High density SNP data Detailed metadata on individual animals GIS data and derived disease/climate information Farming systems analysis Output: Predictions about consequences of change to landscapes Tools to manage landscapes for agriculture Unique probe of genome function

  18. To extract information from distribution is a challenge. • Data collection - metadata • Data management • Data QC • Data integration • Data display tools • Statistics !

More Related