1 / 121

Spectra correspond to entries in “protein identification file.xls”

Spectra correspond to entries in “protein identification file.xls”. MS/MS Fragmentation of YYDDNYIDGLFEIMRK Found in Q5UR95 , YL577_MIMIV Uncharacterized protein L577 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L577 PE=4 SV=1

roch
Télécharger la présentation

Spectra correspond to entries in “protein identification file.xls”

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. Spectra correspond to entries in “protein identification file.xls”

  2. MS/MS Fragmentation of YYDDNYIDGLFEIMRKFound in Q5UR95, YL577_MIMIV Uncharacterized protein L577 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L577 PE=4 SV=1 Match to Query 5087: 2299.094248 from(1150.554400,2+)Title: C:\Andrew Weston\TEMP\2_4067.pkl (query 461)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

  3. MS/MS Fragmentation of YTGTQDNGGVHTNSGIINKFound in P23384, NPRE_BACCL Bacillolysin OS=Bacillus caldolyticus GN=npr PE=1 SV=1 Match to Query 5069: 2288.177448 from(1145.096000,2+)Title: C:\Andrew Weston\TEMP\2_4062.pkl (query 317)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

  4. MS/MS Fragmentation of YTGSQDNGGVHTNSGINNKFound in P43263, NPRE_BREBE Bacillolysin OS=Brevibacillus brevis GN=npr PE=1 SV=1 Match to Query 3726: 2273.106072 from(758.709300,3+)Title: C:\Andrew Weston\TEMP\2_4028.pkl (query 159)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf

  5. MS/MS Fragmentation of YQTLLAEQGAAPVETQHRGKFound in Q7NNH7, RS6_GLOVI 30S ribosomal protein S6 OS=Gloeobacter violaceus GN=rpsF PE=3 SV=1 Match to Query 4349: 2549.352448 from(1275.683500,2+)Title: C:\Andrew Weston\TEMP\2_4042.pkl (query 61)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

  6. MS/MS Fragmentation of WDNEEYWQQAEGKFound in P42852, CUPP_BOMMO Pupal cuticle protein OS=Bombyx mori GN=PCP PE=2 SV=1 Match to Query 3195: 2033.934972 from(678.985600,3+)Title: C:\Andrew Weston\TEMP\2_4037.pkl (query 249)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf

  7. MS/MS Fragmentation of VSTLDMQNLPLTDKFound in Q3IGU4, SYN_PSEHT Asparaginyl-tRNA synthetase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=asnS PE=3 SV=1 Match to Query 4425: 2005.129248 from(1003.571900,2+)Title: C:\Andrew Weston\TEMP\2_4069.pkl (query 359)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

  8. MS/MS Fragmentation of VSQKSLGAVIEDIQKFound in Q73IC3, ENGB_WOLPM Probable GTP-binding protein engB OS=Wolbachia pipientis wMel GN=engB PE=3 SV=1 Match to Query 3843: 2273.037072 from(758.686300,3+)Title: C:\Andrew Weston\TEMP\2_4050.pkl (query 259)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

  9. MS/MS Fragmentation of VQSISLGQGQGPIAEKMVKFound in Q9C0G6, DYH6_HUMAN Dynein heavy chain 6, axonemal OS=Homo sapiens GN=DNAH6 PE=1 SV=3 Match to Query 4406: 2606.289372 from(869.770400,3+)Title: C:\Andrew Weston\TEMP\2_4041.pkl (query 89)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

  10. MS/MS Fragmentation of VAFQAVTKAGQYAYRFound in B6EN31, RL20_ALISL 50S ribosomal protein L20 OS=Aliivibrio salmonicida (strain LFI1238) GN=rplT PE=3 SV=1 Match to Query 4196: 1901.056872 from(634.692900,3+)Title: C:\Andrew Weston\TEMP\2_4062.pkl (query 302)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

  11. MS/MS Fragmentation of VAFQAVTKAGQYAYRFound in B6EN31, RL20_ALISL 50S ribosomal protein L20 OS=Aliivibrio salmonicida (strain LFI1238) GN=rplT PE=3 SV=1 Match to Query 4198: 1901.089272 from(634.703700,3+)Title: C:\Andrew Weston\TEMP\2_4061.pkl (query 125)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

  12. MS/MS Fragmentation of TSALLTCAKDSQFSASYFEAAFFPRFound in Q08844, YO365_YEAST Uncharacterized membrane protein YOR365C OS=Saccharomyces cerevisiae GN=YOR365C PE=1 SV=1 Match to Query 4811: 3267.614896 from(817.911000,4+)Title: C:\Andrew Weston\TEMP\2_4051.pkl (query 166)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

  13. MS/MS Fragmentation of TQLYNFKKFound in P40086, COX15_YEAST Cytochrome c oxidase assembly protein COX15 OS=Saccharomyces cerevisiae GN=COX15 PE=1 SV=1 Match to Query 2289: 1542.744672 from(515.255500,3+)Title: C:\Andrew Weston\TEMP\2_4048.pkl (query 237)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

  14. MS/MS Fragmentation of TPLIISGGSSSRINLYKFound in Q6F260, SECA_MESFL Protein translocase subunit secA OS=Mesoplasma florum GN=secA PE=3 SV=1 Match to Query 3741: 2273.277448 from(1137.646000,2+)Title: C:\Andrew Weston\TEMP\2_4031.pkl (query 351)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf

  15. MS/MS Fragmentation of TNISHNGTYHCSGMGKHRFound in P12314, FCGR1_HUMAN High affinity immunoglobulin gamma Fc receptor I OS=Homo sapiens GN=FCGR1A PE=1 SV=2 Match to Query 4399: 2606.171048 from(1304.092800,2+)Title: C:\Andrew Weston\TEMP\2_4055.pkl (query 346)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

  16. MS/MS Fragmentation of TLSFGSDLNYSTKFound in Q6PCR7, EIF3A_DANRE Eukaryotic translation initiation factor 3 subunit A OS=Danio rerio GN=eif3a PE=2 SV=1 Match to Query 3127: 1943.017296 from(486.761600,4+)Title: C:\Andrew Weston\TEMP\2_4051.pkl (query 133)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

  17. MS/MS Fragmentation of TKASIPNVAPVNINGGGGSRFound in P97528, CNTN6_RAT Contactin-6 OS=Rattus norvegicus GN=Cntn6 PE=1 SV=1 Match to Query 3661: 2219.011448 from(1110.513000,2+)Title: C:\Andrew Weston\TEMP\2_4047.pkl (query 196)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

  18. MS/MS Fragmentation of TIPECQELLPKFound in P51044, CISY_ASPNG Citrate synthase, mitochondrial OS=Aspergillus niger GN=cit-1 PE=2 SV=1 Match to Query 2282: 1540.912572 from(514.644800,3+)Title: C:\Andrew Weston\TEMP\2_4046.pkl (query 155)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

  19. MS/MS Fragmentation of TGTSVSLGKFound in Q9FDN7, FPRA_MOOTA Nitric oxide reductase OS=Moorella thermoacetica (strain ATCC 39073) GN=fprA PE=1 SV=1 Match to Query 950: 1076.634048 from(539.324300,2+)Title: C:\Andrew Weston\TEMP\2_4060.pkl (query 73)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

  20. MS/MS Fragmentation of SYTINSNSLLLNSTLQKFound in P35194, UTP20_YEAST U3 small nucleolar RNA-associated protein 20 OS=Saccharomyces cerevisiae GN=UTP20 PE=1 SV=3 Match to Query 3621: 2249.793248 from(1125.903900,2+)Title: C:\Andrew Weston\TEMP\2_4030.pkl (query 86)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf

  21. MS/MS Fragmentation of SVNLNNNKFound in Q55BF4, UCPA_DICDI Mitochondrial substrate carrier family protein ucpA OS=Dictyostelium discoideum GN=ucpA PE=3 SV=1 Match to Query 919: 1173.590848 from(587.802700,2+)Title: C:\Andrew Weston\TEMP\2_4049.pkl (query 65)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

  22. MS/MS Fragmentation of SVKINLPHFTLIGATTRFound in A8EZ44, RUVB_RICCK Holliday junction ATP-dependent DNA helicase ruvB OS=Rickettsia canadensis (strain McKiel) GN=ruvB PE=3 SV=1 Match to Query 3662: 2219.021848 from(1110.518200,2+)Title: C:\Andrew Weston\TEMP\2_4054.pkl (query 315)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

  23. MS/MS Fragmentation of SVKINLPHFTLIGATTRFound in A8EZ44, RUVB_RICCK Holliday junction ATP-dependent DNA helicase ruvB OS=Rickettsia canadensis (strain McKiel) GN=ruvB PE=3 SV=1 Match to Query 4850: 2219.028848 from(1110.521700,2+)Title: C:\Andrew Weston\TEMP\2_4069.pkl (query 571)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

  24. MS/MS Fragmentation of STQGTTKFound in P32330, YKM1_YEAST WD repeat-containing protein YKL121W OS=Saccharomyces cerevisiae GN=YKL121W PE=1 SV=1 Match to Query 609: 991.519448 from(496.767000,2+)Title: C:\Andrew Weston\TEMP\2_4070.pkl (query 28)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

  25. MS/MS Fragmentation of SSCPLANSQYATIKFound in Q1RML7, MAK16_BOVIN Protein MAK16 homolog OS=Bos taurus GN=MAK16 PE=2 SV=1 Match to Query 2671: 1710.754448 from(856.384500,2+)Title: C:\Andrew Weston\TEMP\2_4050.pkl (query 211)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

  26. MS/MS Fragmentation of SRQGKGNLGSLQLEVRLRFound in Q6PFQ7, RASL2_MOUSE Ras GTPase-activating protein 4 OS=Mus musculus GN=Rasa4 PE=2 SV=1 Match to Query 3910: 2284.198096 from(572.056800,4+)Title: C:\Andrew Weston\TEMP\2_4049.pkl (query 167)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

  27. MS/MS Fragmentation of SLLSNRTKFound in P27754, RT03_OENBE Ribosomal protein S3, mitochondrial OS=Oenothera bertiana GN=RPS3 PE=3 SV=2 Match to Query 1196: 1228.504048 from(615.259300,2+)Title: C:\Andrew Weston\TEMP\2_4045.pkl (query 9)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

  28. MS/MS Fragmentation of SLDLLAQARRMAPGLNTKFound in B5EAX0, LIPA_GEOBB Lipoyl synthase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=lipA PE=3 SV=1 Match to Query 3981: 2307.289272 from(770.103700,3+)Title: C:\Andrew Weston\TEMP\2_4049.pkl (query 146)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

  29. MS/MS Fragmentation of SLDLLAQARRMAPGLNTKFound in B5EAX0, LIPA_GEOBB Lipoyl synthase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=lipA PE=3 SV=1 Match to Query 3986: 2307.480672 from(770.167500,3+)Title: C:\Andrew Weston\TEMP\2_4051.pkl (query 397)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

  30. MS/MS Fragmentation of SLAIDPSGTWLATGGDDGTVRVWELLTGKFound in A6RRD4, ERB1_BOTFB Ribosome biogenesis protein erb1 OS=Botryotinia fuckeliana (strain B05.10) GN=erb1 PE=3 SV=1 Match to Query 4815: 3324.552096 from(832.145300,4+)Title: C:\Andrew Weston\TEMP\2_4041.pkl (query 70)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

  31. MS/MS Fragmentation of SKLVPSSSEINVASRFound in P42842, YN53_YEAST Uncharacterized protein YNL313C OS=Saccharomyces cerevisiae GN=YNL313C PE=1 SV=1 Match to Query 3242: 2084.258248 from(1043.136400,2+)Title: C:\Andrew Weston\TEMP\2_4033.pkl (query 167)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf

  32. MS/MS Fragmentation of SILSGMKFound in Q8PS92, DTDA_METMA D-tyrosyl-tRNA(Tyr) deacylase OS=Methanosarcina mazei GN=dtdA PE=3 SV=1 Match to Query 822: 1044.551848 from(523.283200,2+)Title: C:\Andrew Weston\TEMP\2_4060.pkl (query 29)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

  33. MS/MS Fragmentation of SGNIEDIEVENLINYIKFound in A8GN90, SYP_RICAH Prolyl-tRNA synthetase OS=Rickettsia akari (strain Hartford) GN=proS PE=3 SV=1 Match to Query 4972: 2272.089672 from(758.370500,3+)Title: C:\Andrew Weston\TEMP\2_4072.pkl (query 201)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

  34. MS/MS Fragmentation of SCQPNVELVTIKFound in P36124, SET3_YEAST SET domain-containing protein 3 OS=Saccharomyces cerevisiae GN=SET3 PE=1 SV=1 Match to Query 2583: 1682.900848 from(842.457700,2+)Title: C:\Andrew Weston\TEMP\2_4050.pkl (query 330)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

  35. MS/MS Fragmentation of SANNLIEALKFound in Q3AUH7, DNLJ_SYNS9 DNA ligase OS=Synechococcus sp. (strain CC9902) GN=ligA PE=3 SV=1 Match to Query 1669: 1342.657248 from(672.335900,2+)Title: C:\Andrew Weston\TEMP\2_4055.pkl (query 314)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

  36. MS/MS Fragmentation of RYPGQTEQEMILEVCGSGFLKQMVRFound in C6BW69, TRUA_DESAD tRNA pseudouridine synthase A OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=truA PE=3 SV=1 Match to Query 4465: 3210.401172 from(1071.141000,3+)Title: C:\Andrew Weston\TEMP\2_4027.pkl (query 48)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf

  37. MS/MS Fragmentation of RYPGQTEQEMILEVCGSGFLKQMVRFound in C6BW69, TRUA_DESAD tRNA pseudouridine synthase A OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=truA PE=3 SV=1 Match to Query 5956: 3210.598572 from(1071.206800,3+)Title: C:\Andrew Weston\TEMP\2_4060.pkl (query 167)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

  38. MS/MS Fragmentation of RQQVMPPTEQSKRPRFound in Q8CHI8, EP400_MOUSE E1A-binding protein p400 OS=Mus musculus GN=Ep400 PE=1 SV=2 Match to Query 3568: 2188.031848 from(1095.023200,2+)Title: C:\Andrew Weston\TEMP\2_4054.pkl (query 343)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

  39. MS/MS Fragmentation of RNVVKSMQGADLTQRFound in P54122, RNJ_CORGL Ribonuclease J OS=Corynebacterium glutamicum GN=Cgl1970 PE=3 SV=2 Match to Query 3146: 1948.959248 from(975.486900,2+)Title: C:\Andrew Weston\TEMP\2_4054.pkl (query 404)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

  40. MS/MS Fragmentation of RMLLSTCKNFLSLQSCVYYEDIYYYEEIHKFound in Q5UR85, YR636_MIMIV Putative FNIP repeat-containing protein R636 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R636 PE=4 SV=1 Match to Query 4590: 4684.895296 from(1172.231100,4+)Title: C:\Andrew Weston\TEMP\2_4038.pkl (query 395)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf

  41. MS/MS Fragmentation of RCSVSVCGKFound in Q6P2L6, NSD3_MOUSE Histone-lysine N-methyltransferase NSD3 OS=Mus musculus GN=Whsc1l1 PE=1 SV=2 Match to Query 806: 1167.541248 from(584.777900,2+)Title: C:\Andrew Weston\TEMP\2_4040.pkl (query 288)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf

  42. MS/MS Fragmentation of RASQGLISAVENSESDSSEAKEEVSRFound in Q6PR54, RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus GN=Rif1 PE=1 SV=2 Match to Query 4729: 3153.511272 from(1052.177700,3+)Title: C:\Andrew Weston\TEMP\2_4051.pkl (query 535)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

  43. MS/MS Fragmentation of QYVNVVEYLIRKFound in Q9J4Z9, V241_FOWPV Putative ankyrin repeat protein FPV241 OS=Fowlpox virus GN=FPV241 PE=4 SV=1 Match to Query 2943: 1831.803372 from(611.608400,3+)Title: C:\Andrew Weston\TEMP\2_4057.pkl (query 136)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

  44. MS/MS Fragmentation of QYGLSYVKFound in A7I2F2, SUCC_CAMHC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=sucC PE=3 SV=1 Match to Query 1301: 1264.685448 from(633.350000,2+)Title: C:\Andrew Weston\TEMP\2_4037.pkl (query 80)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf

  45. MS/MS Fragmentation of QVMEEAGKFound in Q90871, IRF8_CHICK Interferon regulatory factor 8 OS=Gallus gallus GN=IRF8 PE=2 SV=1 Match to Query 766: 1134.563848 from(568.289200,2+)Title: C:\Andrew Weston\TEMP\2_4049.pkl (query 15)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

  46. MS/MS Fragmentation of QVLKTVDVPTGSSVRFound in Q4ZNP2, RNFH_PSEU2 Protein rnfH OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rnfH PE=3 SV=1 Match to Query 2981: 1894.035672 from(632.352500,3+)Title: C:\Andrew Weston\TEMP\2_4035.pkl (query 478)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf

  47. MS/MS Fragmentation of QTGGLTRAMDRGCKFound in Q751N2, ATM1_ASHGO Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ashbya gossypii GN=ATM1 PE=3 SV=1 Match to Query 3978: 1777.831848 from(889.923200,2+)Title: C:\Andrew Weston\TEMP\2_4062.pkl (query 147)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf

  48. MS/MS Fragmentation of QTFVRMLTCRKFound in Q646A3, TA2R8_GORGO Taste receptor type 2 member 8 OS=Gorilla gorilla gorilla GN=TAS2R8 PE=3 SV=1 Match to Query 2754: 1764.757448 from(883.386000,2+)Title: C:\Andrew Weston\TEMP\2_4036.pkl (query 356)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf

  49. MS/MS Fragmentation of QTEAENNTLKFound in Q6NY15, TSG10_MOUSE Testis-specific gene 10 protein OS=Mus musculus GN=Tsga10 PE=1 SV=1 Match to Query 2011: 1457.727648 from(729.871100,2+)Title: C:\Andrew Weston\TEMP\2_4056.pkl (query 142)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

  50. MS/MS Fragmentation of QSLQAVLPEISGNKTSPLRFound in A7ZVM4, IRAD_ECO24 Anti-adapter protein iraD OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=iraD PE=3 SV=2 Match to Query 4348: 2549.341272 from(850.787700,3+)Title: C:\Andrew Weston\TEMP\2_4051.pkl (query 369)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf

More Related