'0 kb' diaporamas de présentation

Remote I/O in Condor

Remote I/O in Condor. Outline. Introduction Using Remote I/O Under the Hood Build Your Own: Bypass Conclusion. Introduction. The National Technology Grid provides you with access to a diverse array of machines.

868 views • 77 slides

Condor by Example

Condor by Example. Outline. Overview Submitting Jobs, Getting Feedback Setting Requirements with ClassAds Using LOTS of Machines Which Universe? Conclusion. What is Condor?. Condor converts a collection of unrelated workstations into a high-throughput computing facility.

870 views • 76 slides

Condor by Example

Condor by Example. Outline. Overview Submitting Jobs, Getting Feedback Setting Requirements with ClassAds Using LOTS of Machines Which Universe? Conclusion. What is Condor?. Condor converts a collection of unrelated workstations into a high-throughput computing facility.

958 views • 76 slides

Carlo M. Croce, M.D. The Ohio State University Comprehensive Cancer Center

832 views • 68 slides

Condor by Example

Condor by Example. Lecture Format:. In each lecture: Lecture to whole group. Workshop and examples at computer. Oops! Some items are filled in at the last minute. Please fill the _______ with notes. Outline. Overview Submitting Jobs, Getting Feedback Setting Requirements with ClassAds

710 views • 64 slides

734 views • 56 slides

8 undergrad authors involved in PFGE mapping & transposon mutagenesis

Curiosity, the Internet, & Some Biology Knowledge = Undergraduate Contributions to Genomics Brad Goodner Hiram College. 8 undergrad authors involved in PFGE mapping & transposon mutagenesis. 11 undergrad authors involved in library construction, gap closure, and extensive annotation

488 views • 39 slides

Annotating a Gene Do I Have the Whole Gene?

Annotating a Gene Do I Have the Whole Gene?. Planctomyces limnophilus imidazole glycerol phosphate synthase subunit hisF VKGVNFLNLQDAGDPVEVAARYERDGADELVFLDITASHEERGIIHDVVR RTSEVCFMPLTVGGGIRNLDDIRTLLQAGCDKVSINSAAVKDPEFVRAAA LKFGKQCIVVNIDPRRVTQPDGSVKWEVHINGGRKPTGLEAVSWAKEVER

355 views • 27 slides

100 100 2556 2166 855 1140

A. Placenta mRNA. AG05838. AG10942. KB10025. KB7189. KB7621. KB7801. GPC3. 100 100 2556 2166 855 1140. PHYH. 1111 1023 10 100 100 100. b -actin. Hsa. Ppa. Ggo. B. AG13151. AG07999. KB10025. KB6884. KB8592. KB8594. MYLK.

363 views • 26 slides

How to Optimise a Presentation File Size

Taming the Beast. How to Optimise a Presentation File Size. Nick Rumbelow - February 2002. Taming the Beast. Table of Contents. Section 1. Size Does Matter. Section 2. Small is Beautiful. Section 3. All Creatures Great and Small. Taming the Beast. Section 1. Size Does Matter.

347 views • 26 slides

How to Optimise a Presentation File Size

Taming the Beast. How to Optimise a Presentation File Size. Nick Rumbelow - February 2002. Taming the Beast. Table of Contents. Section 1. Size Does Matter. Section 2. Small is Beautiful. Section 3. All Creatures Great and Small. Taming the Beast. Section 1. Size Does Matter.

409 views • 26 slides

AdrenoLeukoDystrophy

443 views • 24 slides

MB 206 : Module 2 - B

MB 206 : Module 2 - B. Extraction of Nucleic Acids (Genomic DNA, mRNA and Plasmid DNA ). Now, what is a plasmid ?. Let us restart with our current Understanding of Plasmids.

430 views • 16 slides

What a Great Time to Teach & Do Research with Undergrads!!

As of 1/3/08: Domain Published Ongoing Archaea 50 68 Bacteria 577 1628 Eucarya 77 891 (+ 114 metagenomes + GEBA plan). What a Great Time to Teach & Do Research with Undergrads!!. So many questions! So many great tools! Too few researchers!. So much data!.

211 views • 15 slides

A Case For Clean Energy

245 views • 15 slides

Mystery Plasmid B ??????

239 views • 12 slides

Immersive Subjective Testing

Immersive Subjective Testing. Proof of Concept. Video Quality Subjective Testing. Psychophysics Can you see a difference?. What is Missing?. Usability. Immersion. Unique SRC x HRC Mapping. Immersion. Audiovisual 1 minute SRC Distractor questions 35-40 subjects. Speech Quality Test.

219 views • 12 slides

1.0

Fig. 1S. Sal I. Sal I. putative Oxide reductase. Putative ATPase. SsGDA1. 4.0. 7.0. 0. 3.0. 5.0. 6.0. 1.0. 2.0. 1.0 kb. Fig. 2S. Fig. 3S. *. nmoles Pi min -1 total protein -1.

148 views • 3 slides

Additional file 1 Evaluation of the number of integrated copies

Additional file 1 Evaluation of the number of integrated copies. A. 3.5 kb. AgeI. P-HTG. 2.0 kb. 1.6 kb. ATG. HTG. ?neo. 1.4 kb. 0.9 kb. P SV40. P SV40. P SV40. P SV40. wt 1* 2* 3 4* 5. B. 21 kb. AgeI. 5.0 kb. 2.0 kb. 0.9 kb.

92 views • 1 slides

156 kb

103 views • 1 slides