'Word size' diaporamas de présentation

Informatics

Informatics. Module 7 Part 3. Fundamental Knowledge. Basic Computer Terminology Integrating Healthcare Enterprise (IHE) PACS Radiology Information System (RIS) Hospital Information System (HIS) Electronic Medical Record (EMR) Health Level 7 (HL7) Networks Film Digitizers

1.19k views • 94 slides

NCBI Molecular Biology Resources

NCBI Molecular Biology Resources. A Field Guide Part 2. January 12, 2007. Web Access. Text. Entrez. Sequence. BLAST. Structure. VAST. Genomic Biology. Eukaryotic Projects. Mammals with Genomes. Links to Genomic Sequences. Dog WGS project. Dog chromosomes. Armadillo WGS project.

910 views • 75 slides

NCBI Molecular Biology Resources

861 views • 71 slides

Having a BLAST

BLAST algorithms. Having a BLAST. MLW2013, 2011. BiGCaT bioinformatics. Topics of this lecture. Introduction to BLAST Details on the BLAST algorithm Performing a BLAST Pitfalls Advanced BLAST PSI-BLAST PHI-BLAST. Introduction to BLAST. History of BLAST. Local alignment:

1.73k views • 70 slides

573 views • 48 slides

NCBI Molecular Biology Resources

NCBI Molecular Biology Resources. Using NCBI BLAST. Peter Cooper. March 2007. Sequence Similarity Searching. B asic L ocal A lignment S earch T ool. What BLAST tells you. BLAST reports surprising alignments Different than chance Assumptions Random sequences Constant composition

625 views • 43 slides

How do you gauge significance in sequence comparisons?

461 views • 39 slides

Computers Are Your Future

469 views • 35 slides

Linking the Components

4. Linking the Components. The Bus and Word Size. Internal components are: linked by a bus designed around a common word size Word size affects: processing speed memory capacity precision instruction set size cost. Fig. 4.1a: A machine cycle.

428 views • 31 slides

Bits and Bytes CSCi 2021 : Machine Architecture and Organization

Bits and Bytes CSCi 2021 : Machine Architecture and Organization. Chapter 2.1. Today: Bits, Bytes, and Integers. Representing information as bits Bit-level manipulations Integers Representation: unsigned and signed Conversion, casting Expanding, truncating

520 views • 28 slides

Word-Size Optimization for Low Energy, Variable Workload Sub-threshold Systems

423 views • 28 slides

Bioinformatics and Protein Sequence Analysis

Surabhi Agarwal. Bioinformatics and Protein Sequence Analysis.

754 views • 26 slides

Selection of Optimal DNA Oligos for Gene Expression Arrays

Selection of Optimal DNA Oligos for Gene Expression Arrays. Reporter : Wei-Ting Liu Date : Nov. 7 2003. Abstract. Selection of optimal DNA oligos - Based on sequence information and hybridization free energy - Minimize background hybridization (true expression)

376 views • 24 slides

336 views • 23 slides

Buffered dynamic run-time profiling of arbitrary data for Virtual Machines which employ interpreter and Just-In-Time (JI

436 views • 22 slides

419 views • 19 slides

Computer Storage & Representing Numbers

Computer Storage & Representing Numbers. CE 311 K - Introduction to Computer Methods Daene C. McKinney. Introduction. Computer Storage Binary Numbers Bits & Bytes Computer Storage and Number Representation. Computer Storage. Numbers and letters - not stored using symbols we recognize

334 views • 18 slides

Week 4.3

Week 4.3. Concision Review and Commas. Lesson Objectives. Review concision so students can incorporate these skills into draft 1.2 Discuss balance between sources and synthesis in draft 1.2 Review comma usages: When and Where?. Concision Practice.

294 views • 13 slides

Characters and Verbs

Characters and Verbs. Week 5.1. Lesson Objectives. Discuss balance between synthesis and summary for draft 1.2 Connect subjects to characters, and verbs to actions Revise for strong verbs Avoid passive voice Review Brief Assignment Four. Draft 1.2: Balance.

282 views • 11 slides

How Blast Works Role of Word Size, T, & Scoring Matrix in Seeding

How Blast Works Role of Word Size, T, & Scoring Matrix in Seeding. Query: METGAAAALGMALAAGLGALGAAIGDGICTSKLLEGVARQPEARGQLMTLMFISVGLIESIPIIAVVVAFMLMGKIA Database entry#1: MEVGAAAAIATGLAVGLGALGAAVGDGICTGKAIESIARQPEAKGTIQTTMFISVGLIESIPIIAVVLAFMLFGKLG. Database entry#2:

238 views • 4 slides