tarak
Uploaded by
38 SLIDES
500 VUES
380LIKES

Multiple Sequence Alignment (MSA)

DESCRIPTION

Understand Multiple Sequence Alignment (MSA) & challenges. Learn about global alignment, scoring scheme, aligning multiple sequences, dynamic programming, progressive alignment & Clustal method.

1 / 38

Télécharger la présentation

Multiple Sequence Alignment (MSA)

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. Multiple Sequence Alignment (MSA)

  2. Multiple Alignment • Number of sequences >2 • Global alignment • Seek an alignment that maximizes score

  3. Multiple Alignment Multiple sequence alignment can be viewed as an extension of pairwise sequence alignment, but the complexity of the computation grows exponentially with the number of sequences being considered and their lengths and, therefore, it is not feasible to search exhaustively for the optimal alignment even for even a modest number of short sequences. For example, there are approximately 1038 possible alignments that can be produced from five 10-nucleotide-long sequences

  4. Possible Alignments TCGGCTCGACGAGCGTGAT-GGCGAGC---CGTCGTAAC- TCG-GC-TCGACGAGCGT-GAT--G-GCG-AG---CCG-TCGTA--AC … 1038

  5. Multiple Alignment • In addition to the scores employed by pairwise alignment, we have additional scores. • However, we still seek an alignment that maximizes score

  6. Similarity Scoring Scheme {4,0,0,0,0} = 1 {3,1,0,0,0} = 0.75 {2,2,0,0,0} = 0.5 {2,1,1,0,0} = 0.5 {1,1,1,1,0} = 0 5 character states: A, C, T, G, –

  7. Two Possible Alignments GTCGTAGTCGGCTCGACGTCTAGCGAGCGTGAT-GCGAAGAGGCGAGC---GCCGTCGCGTCGTAAC- 1*1 + 3*0.75 + 12*0.5 = 9.25 4*1 + 13*0.75 + 2*0.5 = 11.75 GTCGTAGTCG-GC-TCGACGTC-TAG-CGAGCGT-GATGC-GAAG-AG-GCG-AG-CGCCGTCG-CG-TCGTA-AC

  8. Alignments can be easy or difficult Easy Difficult

  9. Multiple Alignment • Dynamic programming (exhaustive, exact) • Consider 2 protein sequences of 100 amino acids in length. • If it takes 1002 (103) seconds to exhaustively align these sequences, then it will take 104 seconds to align 3 sequences, 105 to align 4 sequences, etc. • It will take ~1021 seconds to align 20 sequences. One year is ~3 ✕107 seconds. The age of the visible universe is ~1018 seconds. • Progressive alignment (heuristic, approximate)

  10. Progressive Alignment • Devised by Feng and Doolittle in 1987. • Essentially a heuristic method and, as such, not guaranteed to find the “optimal” or “best” alignment. • Requires pairwise alignments as a starting point • One of the first successful implementation was Clustal (by Des Higgins et al.)

  11. Based on pairwise alignment scores • Build n by n table of pairwise scores • Align similar sequences first • After alignment, consider as single sequence • Continue aligning with further sequences • Sum of pairwise alignment scores • For n sequences, there are n(n-1)/2 pairs GTCGTAGTCG-GC-TCGACGTC-TAG-CGAGCGT-GATGC-GAAG-AG-GCG-AG-CGCCGTCG-CG-TCGTA-AC

  12. First step: A B C D Compute the pairwise alignments for all against all (6 pairwise alignments) the similarities are stored in a table

  13. A B C D Second step: • Cluster the sequences to create a tree (guide tree): • Represents the order in which pairs of sequences are to be aligned • Similar sequences are neighbors in the tree • Distant sequences are distant from each other in the tree Guide tree

  14. Guide Tree A guide tree is not a phylogenetic tree!

  15. A B C D Third step: Align most similar pairs Align the alignments as if each of them was a single sequence (replace with a single consensus sequence or use a profile)

  16. Alignment of alignments M Q T F L H T W L Q S W X M Q T - F L H T - W L Q S - W L - T I F M - T I W L T I F M T I W Y

  17. Input File > Usually FASTA format

  18. Input file > Sulfolobus acidocaldarius gi|152927|gp|J03218|SSOATPMA_1 MVSEGRVVRVNGPLVIADGMREAQMFEVVYVSDLKLVGEITRIE > Thermococcus sp. gi|2605627 ATPase alpha subunit MGRIIRVTGPLVVADGMKGAKMYEVVRVGEMGLIGEIIRLEGDKAVIQVYEETAGIRPGEPVEGTGSSLS > Acetabularia acetabulum gi|1303673|gnl|PID|d1009732 adenosine triphosphatase A subunit MSKAKEGDYGSIKKVSGPVVVADNMGGSAMYELVRVGTGELIGEIIRLEGDTATIQVYEETSGLTVGDGV … Output file

  19. MSA: Problems Sequences that are similar only in some smaller regions may be misaligned because MSA tries to find global, rather than local alignments. Sequence that contains a large insertion compared to the rest may be misaligned because MSA tries to find global, rather than local alignments.

  20. VS MSA: Problems Sequence that contains a repetitive element (such as a domain), while another sequence only contains one copy.

  21. MSA: Problems • Pairwise alignment is an optimal algorithm. • Multiple alignment is not an optimal algorithm. Better alignments might exist! • The algorithm yields a possible alignment, but not necessarily the best one.

  22. MSA: Problems • Because of the progressive methodology, errors at the beginning of the alignment are more important than errors at the end of the alignment.

  23. Clustal: Advice • Sequence weighting (Should we treat all the sequences as equals?) • Position weighting (Should we treat all positions in the sequences as equals?) • Varying substitution matrices • Residue-specific gap penalties and reduced penalties in hydrophilic regions (external regions of protein sequences), encourage gaps in loops rather than in core regions. • Positions in early alignments where gaps have been opened receive locally reduced gap penalties to encourage openings in subsequent alignments • Vary “gap opening penalty” and “gap extension penalty” • Discourage too many gaps, too close to one another • Take into account hydrophilic and hydrophobic structures • Avoid divergent sequences, as they are the most difficult to align

  24. Alignment of protein-coding DNA sequences • It is not very sensible to align the DNA sequences of protein-coding genes. ATGCTGTTAGGG ATGCTCGTAGGG ATGCT-GTTAGGG ATGCTCGTA-GGG The result might be implausible and might not reflect what is known about biological processes. It is much more sensible to translate the sequences into their corresponding amino acid sequences, align these protein sequences and then put the gaps in the DNA sequences according to the amino acid alignment.

  25. Effect of gap penalties on amino-acid alignment Human pancreatic hormone precursor versus chicken pancreatic hormone (a) Penalty for gaps is 0 (b) Penalty for a gap of size k nucleotides is wk = 1 + 0.1k (c) The same alignment as in (b), only the similarity between the two sequences is further enhanced by showing pairs of biochemically similar amino acids

  26. Anchored alignment: The anchored-alignment procedure uses expert knowledge to improve multiple alignments. The user can specify a list of anchor points, each of which consists of a pair of equal-length segments that are to be aligned by the program. If residue x from one of the input sequences is paired to residue y from another sequence, then y is the only residue that can be aligned to x, and vice versa. All residues to the left and the right of x are aligned, respectively, to the residues to the left and the right of y.

  27. Consider, for example, the following example: >seq1 WKKNADAPKRAMTSFMKAAY >seq2 WNLDTNSPEEKQAYIQLAKDDRIRYD >seq3 WRMDSNQKNPDSNNPKAAYNKGDANAPK The non-anchored default version of DIALIGN would calculate the following alignment for this input sequence set: seq1 1 WKKNAD-----APKRamtsfmKAAY------------ seq2 1 WNLDTN-----SPEE------KQAYiqlaKDDriryd seq3 1 WRMDSNqknpdSNNP------KAAYn---KGDsnapk

  28. Now let's assume, the user has some expert knowledge about a certain domain that is present in all of the input sequences; the domains in the three sequences are thought to be homologous to each other: >seq1 WKKNADAPKRAMTSFMKAAY >seq2 WNLDTNSPEEKQAYIQLAKDDRIRYD >seq3 WRMDSNQKNPDSNNPKAAYNKGDANAPK The user wants to define this motif as anchor and align the rest of the sequences automatically, given the pre-defined constraints imposed by this anchor. Since anchor points are defined as pairs of equal-length segments, we need two anchor points to enforce alignment of the above motif.

  29. For example, one could choose Anchor point 1: >seq1 WKKNADAPKRAMTSFMKAAY >seq2 WNLDTNSPEEKQAYIQLAKDDRIRYD >seq3 WRMDSNQKNPDSNNPKAAYNKGDANAPK Anchor point 2: >seq1 WKKNADAPKRAMTSFMKAAY >seq2 WNLDTNSPEEKQAYIQLAKDDRIRYD >seq3 WRMDSNQKNPDSNNPKAAYNKGDANAPK If the above motif is to be aligned by our program, these two anchor points need to be specified.

  30. Format for user-defined anchor points: To specify a set of anchor points, a file with the coordinates of these anchor points is needed. Since each anchor point corresponds to a equal-length segment pair involving two of the input sequences, coordinates for anchor points are defined as follows: (1) first sequence involved (2) second sequence involved (3) start of anchor in first sequence (4) start of anchor in second sequence (5) length of anchor. (6) specify a score of an anchor point. This score is necessary to prioritize anchor point in case they are inconsistent with each other, i.e., if not all of them can be used simultaneously for the same alignment. the above coordinates (in the above given order).

  31. 6 1 4 2 6 Thus, the above two anchor points are specified as follows: 1 2 4 6 6 4.5 2 3 6 11 8 1.3 4.5 and 1.3 are (arbitrary) scores for anchor points 1 and 2.

  32. MSA Approaches • Progressive approach: CLUSTALW (CLUSTALX) T-COFFEE PILEUP • Iterative approach (Repeatedly realigned subsets of sequences):MultAlin, DiAlign • Statistical Methods (e.g., Hidden Markov Models) SAM2K • Genetic algorithms SAGA

  33. T-coffee • An MSA program • Uses principles similar to Clustal • Combining sequence alignment method with structural alignment techniques • More accurate but longer running time • Limits to the number of sequences it can align (~100)

  34. MSA: Problems Giddy Landan and Dan Graur. 2007. Heads or Tails: A Simple Reliability Check for Multiple Sequence Alignments. Molecular Biology and Evolution 24(6):1380-1383.

  35. Genomic alignment (with MAUVE)

More Related