1 / 15

Proteome Analyst: Accelerating Protein Research

Utilize Proteome Analyst, an accurate web-based tool that uses machine learning to filter biological data, make predictions on protein function and location, and accelerate protein research.

wade-garza
Télécharger la présentation

Proteome Analyst: Accelerating Protein Research

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. Proteome Analyst:Accelerating Protein Research www.cs.ualberta.ca/~bioinfo

  2. 1953

  3. 1990

  4. $3 billion and 13 years later…

  5. White House, 2000. Courtesy, Reuters.

  6. DNA Sequence 1 cctcgcccgc ctgccgcctt tttgtgcgcg tgtgagtgtg ggccccagcg tgccctcccg 61 ggggtgggtt ccgggcggaa ggcggaggcc cggcgcgcag cccgccgccc gcctgcccgc 121 ggaccgggga gccggggtgc ttggagcggg ggacgccagg cgtgggctgg cggcgggacc 181 aggaggagga ggaggaggag gaggagagcg cgggctggcg cttgcccggg cgcagtcggc 241 ggggaccgag tcgtacttcc tgtgcgaaag gcggcccgac cctaaccgcc accccctccc 301 cctgtctccc tctctgaacc cgcccattgg gggtaggaca ctcagccgtc accgctcgct 361 ctgctggccg ctacctgcag caagataggg ccgccatcgc cgggcgacga cgaggaggag 421 gcggccgccg cagccggggc ccccgccgcc gccggagcga caggtgattt ggcttctgca 481 cagttaggag gagcaccaaa ccgatgggag gttttgtcag ccacacctac aactataaaa 541 gatgaagctg gtaatctagt ccagattcca agtgctgcta cttcaagtgg gcagtatgtt 601 cttccccttc agaatttgca gaatcaacaa atattttccg ttgcaccagg atcagattca 661 tcaaatggta cagtgtccag tgttcaatat caagtgatac cacagatcca gtcagcagat 721 ggtcagcagg ttcaaattgg tttcacaggc tcttcagata atgggggtat aaatcaagaa 781 agcagtcaaa ttcagatcat tcctggctct aatcaaacct tacttgcctc tggaacacct 841 tctgctaaca tccagaatct cataccacag actggtcaag tccaggttca gggagttgca 901 attggtggtt catcttttcc tggtcaaacc caagtagttg ctaatgtgcc tcttggtctg 961 ccaggaaata ttacgtttgt accaatcaat agtgtcgatc tagattcttt gggactctcg 1021 ggcagttctc agacaatgac tgcaggcatt aatgccgacg gacatttgat aaacacagga 1081 caagctatgg atagttcaga caattcagaa aggactggtg agcgggtttc tcctgatatt 1141 aatgaaacta atactgatac agatttattt gtgccaacat cctcttcatc acagttgcct 1201 gttacgatag atagtacagg tatattacaa caaaacacaa atagcttgac tacatctagt

  7. Protein Sequence >UniProt/Swiss-Prot|P30613|KPYR_HUMAN MSIQENISSLQLRSWVSKSQRDLAKSILIGAPGGPAGYLRRASVAQLTQELGTAFFQQQQ LPAAMADTFLEHLCLLDIDSEPVAARSTSIIATIGPASRSVERLKEMIKAGMNIARLNFS HGSHEYHAESIANVREAVESFAGSPLSYRPVAIALDTKGPEIRTGILQGGPESEVELVKG SQVLVTVDPAFRTRGNANTVWVDYPNIVRVVPVGGRIYIDDGLISLVVQKIGPEGLVTQV ENGGVLGSRKGVNLPGAQVDLPGLSEQDVRDLRFGVEHGVDIVFASFVRKASDVAAVRAA LGPEGHGIKIISKIENHEGVKRFDEILEVSDGIMVARGDLGIEIPAEKVFLAQKMMIGRC NLAGKPVVCATQMLESMITKPRPTRAETSDVANAVLDGADCIMLSGETAKGNFPVEAVKM QHAIAREAEAAVYHRQLFEELRRAAPLSRDPTEVTAIGAVEAAFKCCAAAIIVLTTTGRS AQLLSRYRPRAAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIWADDVDRRVQFGIESG KLRGFLRVGDLVIVVTGWRPGSGYTNIMRVLSIS

  8. Annotation • Knowledge of the DNA and protein sequences greatly accelerates lab research to discover protein function • Time- and resource-intensive • Human bottle-neck

  9. Sequence Database Growth Protein Sequences 2 000 000 1 500 000 1 000 000 500 000 0 Unnannotated Protein Sequences (GenPept) Human Annotated Protein Sequences (SwissProt) 86 88 92 94 96 98 00 02 04 Year

  10. Protein Annotation +

  11. Proteome Analyst Proteome Analyst (PA): • is a free, Web-based tool • uses machine learning to make predictions; can explain its predictions • is very accurate (e.g., precision and recall) Goal: Filter vast amounts of biological data and make meaningful predictions on the function and location of proteins; accelerate protein research.

More Related