jael-glenn
Uploaded by
22 SLIDES
492 VUES
230LIKES

Protein structure and evolution

DESCRIPTION

Protein structure and evolution. Protein structure. Primary structure Secondary structure Tertiary structure Quaternary structure. Primary structure. Amino acid sequence, e.g., for tubeworm carbonic anhydrase

1 / 22

Télécharger la présentation

Protein structure and evolution

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript

Playing audio...

  1. Protein structure and evolution

  2. Protein structure • Primary structure • Secondary structure • Tertiary structure • Quaternary structure

  3. Primary structure • Amino acid sequence, e.g., for tubeworm carbonic anhydrase • MAAWDYEANGPATWAKSFPLAAGKKQSPIDIDPASVSKKSTSALVASYNPAASNTLTNTGLSFQVSVDGTLSGGPLGNEYKAASFHFHWSKTSAEGSEHTVAGKAYAAEAHIVHYNAAKYASFQDAVKADDGLAVLATFIQPGATNAGVQKIIDLLPSVPTKGDTATIPGGFDVACLLPGDQSKYWYYPGSLTTPPCFESVTWIVYKDPIQLCENQLAALRKITGCNFRPTLGLCGRQVSSSF

  4. Secondary structure • Alpha helixes and beta sheets • Protein domain-level structure http://www.imb-jena.de/image_library/GENERAL/alpha_r_helix_1.gif http://cnx.org/content/m11614/latest/beta_sheet_cartoon.JPG

  5. Tertiary structure • 3D structure of a protein • Subunit-level structure http://www.biologie.uni-hamburg.de/b-online/fo42/1rus.gif

  6. Quaternary structure • How the subunits interact with eachother • ‘Holoenzyme’-level structure http://www.bact.wisc.edu/Microtextbook/images/book_4/chapter_2/2-30.jpg

  7. Protein evolution What diverges? What is conserved?

  8. What diverges? • Third nucleotide of codons • Silent substitutions • No alteration of primary, secondary, tertiary, quaternary structure

  9. What diverges? • Replacement of one amino acid by a chemically similar one • Alteration of primary structure • No, or minimal, alteration of secondary, tertiary, quaternary structure http://www.neb.com/nebecomm/tech_reference/images/amino.gif

  10. What diverges? • ‘Structural’ amino acids away from the active site http://opm.phar.umich.edu/phpthumb/phpThumb.php?src=../images/proteins/2iwv.gif&w=400

  11. What is conserved? • Active site residues Form I Form II Form I

  12. What is conserved? • Sites of covalent modification • E.g., histidine kinases http://www.uni-kl.de/FB-Biologie/AG-Hakenbeck/TGrebe/HPK/Table5.htm

  13. What is conserved? • Sites that interact with • Other subunits • Allosteric regulators http://www.photosynthesisresearch.org/images/Andersson%20rub2L.jpg

  14. Case study • Carboxysomal carbonic anhydrase

  15. Carbonic anhydrase • Catalyzes the following: • CO2 + H2O H2CO3 • Which in turn facilitates H2CO3  H+ + HCO3 - • 3 families (a, b, g) • Within each family: homologs • Apparent when comparing their amino acid sequences • BUT: each family arose independently http://www.scripps.edu/pub/goodsell/pdb/pdb49/pdb49_1.html

  16. …A fourth family of CA’s? HCO3- HCO3- HCO3- CA CO2 CO2 Ru bisco biomass

  17. Carboxysomal carbonic anhydrase • Carbonic anhydrase activity • But sequence-based methods… • No apparent homologs • Proposed a fourth class of CA’s (e-class) So et al., 2004

  18. Structure of CsoS3 was solved • Protein was • Overexpressed in E. coli • Purified • Crystallized • Structure determined via X-ray absorption

  19. Active site of carboxysomal carbonic anhydrase is same as b-CAs Sawaya, M. R. et al. J. Biol. Chem. 2006;281:7546-7555

  20. Structure based sequence alignment of CsoSCA and beta-carbonic anhydrase homologs Csome { Csome { Csome { Csome { Sawaya, M. R. et al. J. Biol. Chem. 2006;281:7546-7555

  21. Moral of the story Less conserved More conserved • Primary structure • Secondary structure • Tertiary structure

  22. Another moral of the story • Very, very distantly related proteins can reveal their relatedness by examining their structure • Moderately distantly-to-closely-related proteins can reveal their relatedness by examining their sequence

More Related