lgilbert
Uploaded by
87 SLIDES
1281 VUES
870LIKES

Sequence Alignment: Needleman-Wunsch & Smith-Waterman + Dot Plot Analysis

DESCRIPTION

Understand Needleman-Wunsch & Smith-Waterman algorithms, PAM & BLOSUM scoring matrices, affine gap penalties, and dot plot comparisons. Learn how to analyze sequences using dot plots with Dotlet tool. Explore protein sequence alignments and scoring methods.

1 / 87

Download Presentation
Télécharger la présentation

Sequence Alignment: Needleman-Wunsch & Smith-Waterman + Dot Plot Analysis

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. Sequence Alignment

  2. Example x = AGTA m = 1 y = ATA s = -1 d = -1 F(i,j) i = 0 1 2 3 4 F(1, 1) = max{F(0,0) + s(A, A), F(0, 1) – d, F(1, 0) – d} = max{0 + 1, -1 – 1, -1 – 1} = 1 j = 0 1 2 A A G - T T A A 3

  3. The Needleman-Wunsch Matrix x1 ……………………………… xM Every nondecreasing path from (0,0) to (M, N) corresponds to an alignment of the two sequences y1 ……………………………… yN An optimal alignment is composed of optimal subalignments

  4. AKRANR KAAANK -1 + (-1) + (-2) + 5 + 7 + 3 = 11 Scoring Matrix: Example • Notice that although R and K are different amino acids, they have a positive score. • Why? They are both positively charged amino acids will not greatly change function of protein.

  5. PAM • Point Accepted Mutation (Dayhoff et al.) • 1 PAM = PAM1 = 1% average change of all amino acid positions • After 100 PAMs of evolution, not every residue will have changed • some residues may have mutated several times • some residues may have returned to their original state • some residues may not changed at all

  6. PAMX • PAMx = PAM1x • PAM250 = PAM1250 • PAM250 is a widely used scoring matrix: Ala Arg Asn Asp Cys Gln Glu Gly His Ile Leu Lys ... A R N D C Q E G H I L K ... Ala A 13 6 9 9 5 8 9 12 6 8 6 7 ... Arg R 3 17 4 3 2 5 3 2 6 3 2 9 Asn N 4 4 6 7 2 5 6 4 6 3 2 5 Asp D 5 4 8 11 1 7 10 5 6 3 2 5 Cys C 2 1 1 1 52 1 1 2 2 2 1 1 Gln Q 3 5 5 6 1 10 7 3 7 2 3 5 ... Trp W 0 2 0 0 0 0 0 0 1 0 1 0 Tyr Y 1 1 2 1 3 1 1 1 3 2 2 1 Val V 7 4 4 4 4 4 4 4 5 4 15 10

  7. BLOSUM • Blocks Substitution Matrix • Scores derived from observations of the frequencies of substitutions in blocks of local alignments in related proteins • Matrix name indicates evolutionary distance • BLOSUM62 was created using sequences sharing no more than 62% identity

  8. The Blosum50 Scoring Matrix

  9. Local Alignment: Free Rides Yeah, a free ride! Vertex (0,0) The dashed edges represent the free rides from (0,0) to every other node.

  10. Notice there is only this change from the original recurrence of a Global Alignment The Local Alignment Recurrence • The largest value of si,j over the whole edit graph is the score of the best local alignment. • The recurrence: 0 si,j = max si-1,j-1 + δ(vi, wj) s i-1,j + δ(vi, -) s i,j-1 + δ(-, wj) {

  11. The local alignment problem Given two strings x = x1……xM, y = y1……yN Find substrings x’, y’ whose similarity (optimal global alignment value) is maximum x = aaaacccccggggtta y = ttcccgggaaccaacc

  12. The Smith-Waterman algorithm Idea: Ignore badly aligning regions Modifications to Needleman-Wunsch: Initialization: F(0, j) = F(i, 0) = 0 0 Iteration: F(i, j) = max F(i – 1, j) – d F(i, j – 1) – d F(i – 1, j – 1) + s(xi, yj)

  13. This is more likely. This is less likely. Affine Gap Penalties • In nature, a series of k indels often come as a single event rather than a series of k single nucleotide events: ATA__GC ATATTGC ATAG_GC AT_GTGC Normal scoring would give the same score for both alignments

  14. Affine gaps (n) e (n) = d + (n – 1)e | | gap gap open extend To compute optimal alignment, F(i, j): score of alignment x1…xi to y1…yj if xi aligns to yj G(i, j): score if xi aligns to a gap after yj H(i, j): score if yj aligns to a gap after xi V(i, j) = best score of alignment x1…xi to y1…yj d

  15. Needleman-Wunsch with affine gaps Initialization: V(i, 0) = d + (i – 1)e V(0, j) = d + (j – 1)e Iteration: V(i, j) = max{ F(i, j), G(i, j), H(i, j) } F(i, j) = V(i – 1, j – 1) + s(xi, yj) V(i, j – 1) – d G(i, j) = max G(i, j – 1) – e V(i – 1, j) – d H(i, j) = max H(i – 1, j) – e Termination: similar

  16. Pairwise Alignment Tools

  17. What Is a Dot Plot ? • A dot plot is a graphic representation of pairwise similarity • The simplicity of dot plots prevents artifacts • Ideal for looking for features that may come in different orders • Reveal complex patterns • Benefit from the most sophisticated statistical-analysis tool in the universe . . . your brain

  18. What Can You Analyze with a Dot Plot ? • Any pair of sequences • DNA • Proteins • RNA • DNA with proteins • Dotlet is an appropriate tool • To compare full genomes, install the program locally

  19. Some Typical Dot-plot Comparisons • Divergent sequences where only a segment is homologous • Long insertions and deletions • Tandem repeats • The square shape of the pattern is characteristic of these repeats

  20. Using Dotlet • Dotlet is one of the handiest tools for making dot plots • Dotlet is a Java applet • Open and download the applet at the following site: http://myhits.isb-sib.ch/cgi-bin/dotlet • Use Firefox or IE

  21. Two Protein Sequences MIILWSLIVHLQLTCLHLILQTPNLEALDALEIINYQTTKYTIPEVWKEQPVATIGEDVD DQDTEDEESYLKFGDDAEVRTSVSEGLHEGAFCRRSFDGRSGYCILAYQCLHVIREYRVH GTRIDICTHRNNVPVICCPLADKHVLAQRISATKCQEYNAAARRLHLTDTGRTFSGKQCV PSVPLIVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATSG SKPPDMVRLGARQLNETSATQQDIKILIIVLHPKYRSSAYYHDIALLKLTRRVKFSEQVR PACLWQLPELQIPTVVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGI IEGQFCAGYLPGGRDTCQGDSGGPIHALLPEYNCVAFVVGITSFGKFCAAPNAPGVYTRL YSYLDWIEKIAFKQH MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN WIDSIIQRSEDNPCPHPRDPDPASRTH

  22. Window size Threshold window for fine tuning Dot plot window Alignment window

  23. Set Dotlet Parameters • Dotlet slides a window along each sequence • If the windows are more similar than the threshold, Dotlet prints a dot at their intersection • You can control the similarity threshold with the little window on the left Window size Window Size Threshold Threshold

  24. Window size Threshold window for fine tuning Dot plot window Alignment window

  25. The Dotlet Threshold • Every dot has a score given by the window comparison • When the score is • Below threshold 1  black dot • Between thresholds 1 and 2  grey dot • Above threshold 2  white dot • The blue curve is the distribution of scores in the sequences • The peak  most common score, • Most common  less informative Log curve

  26. Window size Threshold window for fine tuning Dot plot window Alignment window

  27. Getting Your Dot Plot Right • Window size and the stringency control the aspect of your dot plot • Very stringent = clean dot plot, little signal • Not stringent enough = noisy dot plot, too much signal • Play with the threshold until a usable signal appears

  28. Which Size for the Window? • Long window • Clean dot plots • Little sensitivity • Short window • Noisy dot plots • Very sensitive • The size of the window should be in the range of the elements you are looking for • Conserved domains: 50 amino acids • Transmembrane segments: 20 amino acids • Shorten the window to compare distantly related sequences

  29. Window size Threshold window for fine tuning Dot plot window Alignment window

  30. Looking at Repeated Domains with Dotlet • The square shape is typical of tandem repeats • The repeats are not perfect because the sequences have diverged after their duplication

  31. Comparing a Gene and Its Product • Eukaryotic genes are transcribed into RNA • The RNA is then spliced to remove the introns’ sequences • It may be necessary to compare the gene and its product • Dotlet makes this comparative analysis easy

  32. Aligning Sequences • Dotlet dot plots are a good way to provide an overview • Dot plots don’t provide residue/residue analysis • For this analysis you need an alignment • The most convenient tool for making precise local alignments is Lalign

  33. Lalign and BLAST • Lalign is like a very precise BLAST • It works on only two sequences at a time • You must provide both sequences

  34. LaLign http://www.ch.embnet.org/software/LALIGN_form.html

  35. Lalign Output • Lalign produces an output similar to the alignment section of BLAST • The E-value indicates the significance of each alignment • Low E-value  good alignment

  36. Going Farther • If you need to align coding DNA with a protein, try these sites: • www.tcoffee.org => protogene • coot.embl.de/pal2nal • If you need to align very large sequences, try this site: • www.ncbi.nlm.nih.gov/blast/bl2seq/wblast2.cgi • If you need a precise estimate of your alignment’s statistical significance, use PRSS • The program is available at fasta.bioch.virginia.edu

  37. Multiple Alignment

  38. Generalizing the Notion of Pairwise Alignment • Alignment of 2 sequences is represented as a 2-row matrix • In a similar way, we represent alignment of 3 sequences as a 3-row matrix A T _ G C G _ A _ C G T _ A A T C A C _ A • Score: more conserved columns, better alignment

  39. Alignments = Paths in… • Align 3 sequences: ATGC, AATC,ATGC

  40. Alignment Paths x coordinate

  41. Alignment Paths • Align the following 3 sequences: • ATGC, AATC,ATGC x coordinate y coordinate

  42. Alignment Paths x coordinate y coordinate z coordinate • Resulting path in (x,y,z) space: • (0,0,0)(1,1,0)(1,2,1) (2,3,2) (3,3,3) (4,4,4)

  43. Aligning Three Sequences source • Same strategy as aligning two sequences • Use a 3-D “”, with each axis representing a sequence to align • For global alignments, go from source to sink sink

More Related
SlideServe
Audio
Live Player
Audio Wave
Play slide audio to activate visualizer