majed
Uploaded by
16 SLIDES
390 VUES
170LIKES

Structural Proteins

DESCRIPTION

Structural Proteins. Presented by: Andrew and Briana. Structural Protein Overview. Largest class of proteins (75% of the dry weight in humans) Generally add stiffness and rigidity to fluid biological components Commonly very fibrous

1 / 16

Télécharger la présentation

Structural Proteins

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. Structural Proteins Presented by: Andrew and Briana

  2. Structural Protein Overview • Largest class of proteins (75% of the dry weight in humans) • Generally add stiffness and rigidity to fluid biological components • Commonly very fibrous • Provide support for both large structures and microscopic structures Microfilaments

  3. Role in Living Things • Keratin • Form strong supercoils • Protective function such as hair, nails, scales, feathers, and beaks • Elastin • Forms connective tissue (allows for stretching) • Tendons, ligaments, skin flexibility, lungs, arteries • Myosin • Role in muscle movement such as hydrolysis of ATP • Fibroin • Insoluble • Parallel sheets form silk used by insects and spiders

  4. More Roles in Organisms • Microtubules • Protein = Tubulin • Cytoskeleton, cellular movement, mitotic spindle • Microfilaments • Protein = Actin • Cytoskeleton, muscle contraction, organelle movement • Intermediate Filaments • Protein = Keratin • Cytoskeleton • Not involved directly in movement

  5. How do they function? • Formation of fibers and filaments contribute to structural strength of proteins • Movement and re-adjustment such as actin or elastin require ATP • Other vitamins such as vitamin C are required for synthesis Polymerization ATP Dependent

  6. Shape and Function • Rigidity of Proteins • Antiparallel chains form super coils • Hardened by hydrogen bonding and disulfide bridges • Flexibility of Proteins • Solubility allows for globular proteins such as tubulin and actin to form into strands • Lateral imperfect helix allows for elongation • Transportation Ability • Polarization allows for transportation of molecules • One negative and one positive end in the structure Dissolve/Polymerize F-Actin Actin

  7. Synthesis of Proteins • Message sent to cell and genetic process begins • Formation of mRNA (Units of 3)

  8. Synthesis of Proteins Cont. • Enters the cytoplasm • Binds to a ribosome

  9. Synthesis of Proteins Cont. • tRNA brings the amino acid to the corresponding code on mRNA • tRNA continues coming until chain is complete (peptide bonds)

  10. Synthesis Miscellaneous • Protein synthesis inhibitors such as the toxin ricin stops the production of protein • Disruptions in translation can lead to mutations and a change in function (1 in 10,000) • Example of such mutation is sickle cell (hemoglobin) • Disruption of protein manufacture can be disastrous

  11. Specific Example: Collagen • The most abundant protein in mammals (25-35%) • Plays a large role in body structure through ligaments and tendons (holds bones and muscles together) • Vital for skin flexibility • Found in stiffer forms such as bone or cartilage

  12. Collagen Structure • 3 alpha peptide strands bonded together • Forms a super helix or 3 part coil • Glycine accounts for 1/3 of the structure to repeated pattern • No R-Group allows for closer connection among helixes, so hydrogen bonding and linking is facilitated • Formation of bundles impact function such as bone vs. ligaments (parallel or unparalleled) Collagen Type 1 Helix

  13. Collagen Genetics • Partial amino sequence: mhpglwlllvtlclteelaaageksygkpcggqdcsgscqcfpekgargrpgpigiqgpt(repeat of g) • Similar to: • Collagen alpha-6(IV) chain, partial [Macacamulatta] 96% • Collagen alpha-6(IV) chain, partial [Macacafascicularis] 96% • Many others predicted relatedness to primates • Indicated a possible conserved gene which shows that many animals may have had similar functional needs and the protein provided similar adaptive advantages

  14. Collagen Disorders • Non-Genetically Related • Osteoporosis, from old age, leads to inflexibility in joints, thinner skin, and weaker bones • Genetically Related • Osteogenesisimperfecta – Mutation leads to weak bones and irregular connective tissue • Ehler-Danlos Syndrome – Varying mutations and effects such as rupture of arteries or deformed connective tissue Impact of Osteogenesisimperfecta EDS Symptoms

  15. In-Depth Disorder: Scurvy • Cause: • Hydroxylation of lysines and prolines is a step that requires vitamin C as a cofactor. In scurvy, the lack of hydroxylation of prolines and lysines causes a looser triple helix (which is formed by 3 alpha peptides) • Symptoms: • Spots on skin • Spongy gums • Loss of teeth • Pain in joints/Overall weakness • Proposed Drug: • Target protein synthesis • A Vitamin C tablet that will provide necessary amounts of vitamins so that collagen can form • Treatment applies to animals such as primates that cannot form their own vitamin C. Other animals produce their own Vitamin C.

  16. From Andrew and Briana Thanks for listening

More Related